(data stored in SCRATCH zone)

EMBL: CP002343.PE92

CP002343.PE92        Location/Qualifiers
FT   CDS             complement(100594..102114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0092"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="COGs: COG2041 Sulfite oxidase; InterPro IPR000572:
FT                   IPR005066: IPR006311; KEGG: nca:Noca_4533 oxidoreductase,
FT                   molybdopterin binding; PFAM: oxidoreductase molybdopterin
FT                   binding; Mo-co oxidoreductase dimerisation domain; SPTR:
FT                   Oxidoreductase, molybdopterin binding; PFAM: Mo-co
FT                   oxidoreductase dimerisation domain; Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46654"
FT                   /db_xref="GOA:E6SFB6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB6"
FT                   /protein_id="ADU46654.1"
FT                   /translation="MGRTNHAGIGVLAASAGLAAGHLSASVDEPAASPLVAVGTAVIDA
FT                   APTPLKELAVATLGTADKPVLIGSVLAITLAVAGLIGILARRRLWVAGALLSALVMVGG
FT                   LAALARPTATARDAVPALAALVVGVGVLVGLTELSRRTVPAGTRPGPAAGRGVSRRAVV
FT                   GASVGVAVGSVLAGVGGQVRATARAARDLVLPRPLVPAAPLPTGLDASVRGISPLQTPT
FT                   DRFYRVDVNLTVPRIDHDSWSLDIDGMVERPLRLTYADLTRMRLVERDITLTCVSNEVG
FT                   GGYVSSGRWLGVLVSDLLEAAGVSGPAEQVLSTAVDGFTISTPLRALTDGRHALVAIGL
FT                   NGAPLPDEHGFPARLVTPGLYGFVGATKWLRRLTVTTYAAEQAYWTRRQWATEAPVKTS
FT                   ARIDTPAPLSTVPSGRVAIGGVAWAQHRGVAAVEVRIDDGLWQPARLGPDIGVDCWRQW
FT                   YLPWDAKPGLHRLAVRATDRTGDVQTADRAAPFPDGSSGIQEVVVTVS"
     MGRTNHAGIG VLAASAGLAA GHLSASVDEP AASPLVAVGT AVIDAAPTPL KELAVATLGT        60
     ADKPVLIGSV LAITLAVAGL IGILARRRLW VAGALLSALV MVGGLAALAR PTATARDAVP       120
     ALAALVVGVG VLVGLTELSR RTVPAGTRPG PAAGRGVSRR AVVGASVGVA VGSVLAGVGG       180
     QVRATARAAR DLVLPRPLVP AAPLPTGLDA SVRGISPLQT PTDRFYRVDV NLTVPRIDHD       240
     SWSLDIDGMV ERPLRLTYAD LTRMRLVERD ITLTCVSNEV GGGYVSSGRW LGVLVSDLLE       300
     AAGVSGPAEQ VLSTAVDGFT ISTPLRALTD GRHALVAIGL NGAPLPDEHG FPARLVTPGL       360
     YGFVGATKWL RRLTVTTYAA EQAYWTRRQW ATEAPVKTSA RIDTPAPLST VPSGRVAIGG       420
     VAWAQHRGVA AVEVRIDDGL WQPARLGPDI GVDCWRQWYL PWDAKPGLHR LAVRATDRTG       480
     DVQTADRAAP FPDGSSGIQE VVVTVS                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page