(data stored in SCRATCH zone)

EMBL: CP002343.PE93

CP002343.PE93        Location/Qualifiers
FT   CDS             complement(102172..102615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO6177 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Polyketide cyclase
FT                   / dehydrase and lipid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46655"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB7"
FT                   /protein_id="ADU46655.1"
FT                   /translation="MATFRVWVSSAVPPDEAWRRVLDLRAHDRVIPLTRVTTGRSAAAD
FT                   LTAGSRFVARTGMGPVGFDDAMVVESITPPRAAEPGSARIRKEGKVVRGSIDLHVQATP
FT                   GGSAVSWTQDIDVRGVPRALGWLTVGASRAAYGWALRRLLRGD"
     MATFRVWVSS AVPPDEAWRR VLDLRAHDRV IPLTRVTTGR SAAADLTAGS RFVARTGMGP        60
     VGFDDAMVVE SITPPRAAEP GSARIRKEGK VVRGSIDLHV QATPGGSAVS WTQDIDVRGV       120
     PRALGWLTVG ASRAAYGWAL RRLLRGD                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page