(data stored in ACNUC7421 zone)

EMBL: CP002343.PE94

CP002343.PE94        Location/Qualifiers
FT   CDS             102732..103565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0094"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073:
FT                   IPR000639; KEGG: nml:Namu_1402 alpha/beta hydrolase fold
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Alpha/beta
FT                   hydrolase fold protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46656"
FT                   /db_xref="GOA:E6SFB8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB8"
FT                   /protein_id="ADU46656.1"
FT                   /translation="MSTRTTTLHGHRLAYVDRGAGPAVLFIHGLLGTNANWSHLVTRLE
FT                   TTHRVVVPDLFGHGASDKPRGDYSLGAHAATLRDLLDRLDIDRVTLVGHSLGGGIALQL
FT                   CYLFPERVDRLVLVSSGGLGRSVSPILRAATLPGAEVVIPVIASGWVRTRLEGLGSALG
FT                   RLGLRPPADVREAWHGFTSLSDADSRRAFLATTRAVIDPGGQTVTAHDHLPMDEDIPTL
FT                   VVWGTHDRMIPAWHATTAHQAIPSSRVELFHGAGHFPHLEEPDRFAALLRDFISR"
     MSTRTTTLHG HRLAYVDRGA GPAVLFIHGL LGTNANWSHL VTRLETTHRV VVPDLFGHGA        60
     SDKPRGDYSL GAHAATLRDL LDRLDIDRVT LVGHSLGGGI ALQLCYLFPE RVDRLVLVSS       120
     GGLGRSVSPI LRAATLPGAE VVIPVIASGW VRTRLEGLGS ALGRLGLRPP ADVREAWHGF       180
     TSLSDADSRR AFLATTRAVI DPGGQTVTAH DHLPMDEDIP TLVVWGTHDR MIPAWHATTA       240
     HQAIPSSRVE LFHGAGHFPH LEEPDRFAAL LRDFISR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page