(data stored in ACNUC7421 zone)

EMBL: CP002343.PE95

CP002343.PE95        Location/Qualifiers
FT   CDS             103797..104177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0095"
FT                   /product="YCII-related protein"
FT                   /note="COGs: COG3795 conserved hypothetical protein;
FT                   InterPro IPR005545; KEGG: amd:AMED_2012 hypothetical
FT                   protein; PFAM: YCII-related; SPTR: YCII-related protein;
FT                   PFAM: YCII-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46657"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB9"
FT                   /protein_id="ADU46657.1"
FT                   /translation="MRYLMIHKLDESLPEAWNPSPEFIDKMGAFMGEVQASGALLAAEG
FT                   VHQSKEGALIRKDTTGLTVTDGPFTEAREVIGGFALVEVADKAEAIQLGQRFADLFPQV
FT                   SVEVRRVFEEEDFGAVADSQDA"
     MRYLMIHKLD ESLPEAWNPS PEFIDKMGAF MGEVQASGAL LAAEGVHQSK EGALIRKDTT        60
     GLTVTDGPFT EAREVIGGFA LVEVADKAEA IQLGQRFADL FPQVSVEVRR VFEEEDFGAV       120
     ADSQDA                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page