(data stored in ACNUC7421 zone)

EMBL: CP002343.PE96

CP002343.PE96        Location/Qualifiers
FT   CDS             104241..105464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0096"
FT                   /product="ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /note="COGs: COG0439 Biotin carboxylase; InterPro
FT                   IPR003135: IPR011761; KEGG: gau:GAU_1512 hypothetical
FT                   protein; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; SPTR: Putative uncharacterized
FT                   protein; PFAM: Carbamoyl-phosphate synthase L chain, ATP
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46658"
FT                   /db_xref="GOA:E6SFC0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC0"
FT                   /protein_id="ADU46658.1"
FT                   /translation="MNIIFVEPAFPANQRRFVHALASVGANVYGIGESDETHLGPDLRG
FT                   AMRGYYRVGSVTNVQQLIDAVRHFQAQVWVDGLEATIEAHTMPAAQAREATGVPGTNVR
FT                   TTWLCRDKPSMKEALRAAGVPTAASAAIDSSAEAKEFADRVGYPLIVKPRTGAGAQGTV
FT                   RVDGDDELADVLHQFGEEGATSLAIEEFVEGHEGFYDTITLDGRVTHDWVTHYYPNVLE
FT                   AMRHRWISPQFVTTNRVDGNDFYAEVRELGRRVVDALGIETSATHMEWFYGPKGLRFSE
FT                   IGCRPPGVGAWDLYSAANEIDVYREWAHVVVHGRPEHQMKRSYAAGLVALRPDRDGVVT
FT                   GYDGIDAVESRYGDWVIDAHFPPPGQPTQPVEAGFMANAWVRLRHPDYDTLRGMLDDVG
FT                   RTVKVHAG"
     MNIIFVEPAF PANQRRFVHA LASVGANVYG IGESDETHLG PDLRGAMRGY YRVGSVTNVQ        60
     QLIDAVRHFQ AQVWVDGLEA TIEAHTMPAA QAREATGVPG TNVRTTWLCR DKPSMKEALR       120
     AAGVPTAASA AIDSSAEAKE FADRVGYPLI VKPRTGAGAQ GTVRVDGDDE LADVLHQFGE       180
     EGATSLAIEE FVEGHEGFYD TITLDGRVTH DWVTHYYPNV LEAMRHRWIS PQFVTTNRVD       240
     GNDFYAEVRE LGRRVVDALG IETSATHMEW FYGPKGLRFS EIGCRPPGVG AWDLYSAANE       300
     IDVYREWAHV VVHGRPEHQM KRSYAAGLVA LRPDRDGVVT GYDGIDAVES RYGDWVIDAH       360
     FPPPGQPTQP VEAGFMANAW VRLRHPDYDT LRGMLDDVGR TVKVHAG                     407
//

If you have problems or comments...

PBIL Back to PBIL home page