(data stored in ACNUC7421 zone)

EMBL: CP002343.PE98

CP002343.PE98        Location/Qualifiers
FT   CDS             106440..107585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0098"
FT                   /product="esterase"
FT                   /note="COGs: COG2382 Enterochelin esterase; InterPro
FT                   IPR000801; KEGG: ppd:Ppro_1478 putative esterase; PFAM:
FT                   esterase; SPTR: Putative esterase; PFAM: Domain of unknown
FT                   function (DUF3327); Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46660"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC2"
FT                   /protein_id="ADU46660.1"
FT                   /translation="MSTRLAINRLRDREPLDDEAVDRFITRYGSPIVEGERATFLWRGH
FT                   ADEARVRHRVVGLPDPLPLAPLPGTDLWFVTTVLPAGSRVEYQIEVRRGEAWEQFNDPL
FT                   NPRLAHSPLGSSSVCASHGYQVPDWVSFDPEARPGTIVEDSIRSKALRREQPISVYLPA
FT                   RFNRALRYPLLVVHDGTDYLGFAAMRTVLDNLIHRLDVDPLVAVFVPPGDRLREYANHA
FT                   PHARFIARELVPLLTERLPLVDAPEARCLMGSSFGGIASLSTAVRYPGYFGSLLLQSAS
FT                   LVFTDIGFAHGGGPAFDPVVSFVNRYRAKPTAVVERIYQSCGVYEPLITPNRSMVPVFR
FT                   QTGMQVRYTEARDGHNWENWRDRLGDGLSWLFPGPQKFVYE"
     MSTRLAINRL RDREPLDDEA VDRFITRYGS PIVEGERATF LWRGHADEAR VRHRVVGLPD        60
     PLPLAPLPGT DLWFVTTVLP AGSRVEYQIE VRRGEAWEQF NDPLNPRLAH SPLGSSSVCA       120
     SHGYQVPDWV SFDPEARPGT IVEDSIRSKA LRREQPISVY LPARFNRALR YPLLVVHDGT       180
     DYLGFAAMRT VLDNLIHRLD VDPLVAVFVP PGDRLREYAN HAPHARFIAR ELVPLLTERL       240
     PLVDAPEARC LMGSSFGGIA SLSTAVRYPG YFGSLLLQSA SLVFTDIGFA HGGGPAFDPV       300
     VSFVNRYRAK PTAVVERIYQ SCGVYEPLIT PNRSMVPVFR QTGMQVRYTE ARDGHNWENW       360
     RDRLGDGLSW LFPGPQKFVY E                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page