(data stored in ACNUC30630 zone)

EMBL: CP002344.PE102

CP002344.PE102       Location/Qualifiers
FT   CDS             104840..105997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0102"
FT                   /product="MazG family protein"
FT                   /note="COGs: COG3956 Protein containing tetrapyrrole
FT                   methyltransferase domain and MazG-like (predicted
FT                   pyrophosphatase) domain; InterPro IPR004518: IPR011551;
FT                   KEGG: bts:Btus_0079 MazG family protein; PFAM: MazG
FT                   nucleotide pyrophosphohydrolase; SPTR: MazG family protein;
FT                   TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase domain; TIGRFAM: MazG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50227"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL25"
FT                   /protein_id="ADU50227.1"
FT                   /translation="MKEEHRTVPDAPGPVGPGPRPADPGPARGAASSGPDPGAGRGAAS
FT                   DAGPGGDPYGFGRVVELVRRLRAPGGCPWDRAQTHRSLRRFALEEAYEVVAAIDAGDPR
FT                   HLADELGDLLLQVLLHAQIAAEAGHFTIADVCHALADKLIRRHPHVFGGVEADSPADVQ
FT                   RLWAAIKRAEAAAREGVPAGEAAGAGGREGGASAAGVPEGQAGAGPAAGEAVAGPPSGA
FT                   AGEPVPEVAGGRDDEPWTPAALVEAYRVQERAARLGLDWPDPRGPRAKLDEELAELDAA
FT                   VAEGDPQHVEEELGDVLFVLVNAGRHWGVHAETALLGAVRKFRRRIHQMEEQARRQGRT
FT                   LEELSPAELDRLWEAAKARETGRIQGLSAEHTSGTRPDARGGKRG"
     MKEEHRTVPD APGPVGPGPR PADPGPARGA ASSGPDPGAG RGAASDAGPG GDPYGFGRVV        60
     ELVRRLRAPG GCPWDRAQTH RSLRRFALEE AYEVVAAIDA GDPRHLADEL GDLLLQVLLH       120
     AQIAAEAGHF TIADVCHALA DKLIRRHPHV FGGVEADSPA DVQRLWAAIK RAEAAAREGV       180
     PAGEAAGAGG REGGASAAGV PEGQAGAGPA AGEAVAGPPS GAAGEPVPEV AGGRDDEPWT       240
     PAALVEAYRV QERAARLGLD WPDPRGPRAK LDEELAELDA AVAEGDPQHV EEELGDVLFV       300
     LVNAGRHWGV HAETALLGAV RKFRRRIHQM EEQARRQGRT LEELSPAELD RLWEAAKARE       360
     TGRIQGLSAE HTSGTRPDAR GGKRG                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page