(data stored in ACNUC30630 zone)

EMBL: CP002344.PE105

CP002344.PE105       Location/Qualifiers
FT   CDS             107080..107745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0105"
FT                   /product="Spore cortex biosynthesis protein, YabQ"
FT                   /note="InterPro IPR019074; KEGG: sth:STH3227 hypothetical
FT                   protein; PFAM: Spore cortex biosynthesis protein,
FT                   YabQ-like; SPTR: Putative uncharacterized protein; PFAM:
FT                   Spore cortex protein YabQ (Spore_YabQ); TIGRFAM: spore
FT                   cortex biosynthesis protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50230"
FT                   /db_xref="GOA:E6SL28"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL28"
FT                   /protein_id="ADU50230.1"
FT                   /translation="MFSLTVQTYMLAVNVALGLTLGFVFDACRALRAVLAGGRPARRPW
FT                   LDAVMDAVFWLAALPAVLLTWGWGNWGQVRLFTFLGLALGLGLYAALGSPVLFPALAAT
FT                   YRATGQGAVRFVRWNRRVARAAGRAAWRGARGLLRLVRWVLKPVTVPLGWLLAPLLAPV
FT                   NRYVVDPVRARVQRFVVEPARRRVAAARHRFAAGWDRLRSVLAAWLRPGEDEPPPPAT"
     MFSLTVQTYM LAVNVALGLT LGFVFDACRA LRAVLAGGRP ARRPWLDAVM DAVFWLAALP        60
     AVLLTWGWGN WGQVRLFTFL GLALGLGLYA ALGSPVLFPA LAATYRATGQ GAVRFVRWNR       120
     RVARAAGRAA WRGARGLLRL VRWVLKPVTV PLGWLLAPLL APVNRYVVDP VRARVQRFVV       180
     EPARRRVAAA RHRFAAGWDR LRSVLAAWLR PGEDEPPPPA T                           221
//

If you have problems or comments...

PBIL Back to PBIL home page