(data stored in ACNUC30630 zone)

EMBL: CP002344.PE107

CP002344.PE107       Location/Qualifiers
FT   CDS             108417..108947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0107"
FT                   /product="Septum formation initiator"
FT                   /note="InterPro IPR007060; KEGG: kra:Krad_1074 septum
FT                   formation initiator; PFAM: Septum formation initiator;
FT                   SPTR: Septum formation initiator; PFAM: Septum formation
FT                   initiator; General secretion pathway protein L (GspL)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50232"
FT                   /db_xref="GOA:E6SL30"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL30"
FT                   /protein_id="ADU50232.1"
FT                   /translation="MGPAGLLRPVPVTPLPRAVPAPVSKGAGRSPAGRPYDPGRALAGR
FT                   EVRGGSGEAVGAATGPRPVRRRWRLRWGRLAATAVAAYLLAGLVLQQVALWQARQELRA
FT                   LDRQLQELRGQQAELRAAEQRVDDPAYVDETARQRLGLVKPGETVIQLVDEPGAAGSPA
FT                   AQSPGSPGAPAGR"
     MGPAGLLRPV PVTPLPRAVP APVSKGAGRS PAGRPYDPGR ALAGREVRGG SGEAVGAATG        60
     PRPVRRRWRL RWGRLAATAV AAYLLAGLVL QQVALWQARQ ELRALDRQLQ ELRGQQAELR       120
     AAEQRVDDPA YVDETARQRL GLVKPGETVI QLVDEPGAAG SPAAQSPGSP GAPAGR           176
//

If you have problems or comments...

PBIL Back to PBIL home page