(data stored in ACNUC30630 zone)

EMBL: CP002344.PE124

CP002344.PE124       Location/Qualifiers
FT   CDS             complement(126522..127856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0124"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: tth:TTC0899 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: Hypothetical membrane spanning
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50249"
FT                   /db_xref="GOA:E6SL47"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL47"
FT                   /protein_id="ADU50249.1"
FT                   /translation="MDGRTLALAGLTLVFWSSAFTVIRAGLAYWSPGQLALVRFLVASV
FT                   ALAVGIGLQHAARRRGQRAGACRGRGLRPDRVRWAAPGKPAAAANGRPGPHGPHDARRR
FT                   LPLRDAGRFLVLGATGIFLYHTGLNWGETRVPAGTASLLVATAPALTALLSRLWLGERL
FT                   APRAWLGLALSFTGVAIISWAASTGPVSPAGMAGAVKPLSASGPAGLAAQTVPGDGAGG
FT                   GPMGSLQAGISAAAGFGSPGAPAGWAGPAAVGGAALATSAFFVLQRPLASRYGSLELTA
FT                   FYTWAGTLLLALAFGPGLVADLQAGRIPPAAWIPALYLGLFPSALAYWAWSAALARDSA
FT                   ARVASLLNLNPLLAVATAWIALGERPSWVELAGGAVALAGVLLVQGRPPTPQGQRPGSF
FT                   RRQDPPPVPVAAEPAPPTPPAAVPVEPGGSPAGPGDRPSPRPGGR"
     MDGRTLALAG LTLVFWSSAF TVIRAGLAYW SPGQLALVRF LVASVALAVG IGLQHAARRR        60
     GQRAGACRGR GLRPDRVRWA APGKPAAAAN GRPGPHGPHD ARRRLPLRDA GRFLVLGATG       120
     IFLYHTGLNW GETRVPAGTA SLLVATAPAL TALLSRLWLG ERLAPRAWLG LALSFTGVAI       180
     ISWAASTGPV SPAGMAGAVK PLSASGPAGL AAQTVPGDGA GGGPMGSLQA GISAAAGFGS       240
     PGAPAGWAGP AAVGGAALAT SAFFVLQRPL ASRYGSLELT AFYTWAGTLL LALAFGPGLV       300
     ADLQAGRIPP AAWIPALYLG LFPSALAYWA WSAALARDSA ARVASLLNLN PLLAVATAWI       360
     ALGERPSWVE LAGGAVALAG VLLVQGRPPT PQGQRPGSFR RQDPPPVPVA AEPAPPTPPA       420
     AVPVEPGGSP AGPGDRPSPR PGGR                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page