(data stored in ACNUC30630 zone)

EMBL: CP002344.PE127

CP002344.PE127       Location/Qualifiers
FT   CDS             131575..132273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0127"
FT                   /product="protein of unknown function DUF159"
FT                   /note="COGs: COG2135 conserved hypothetical protein;
FT                   InterPro IPR003738; KEGG: cyb:CYB_0679 hypothetical
FT                   protein; PFAM: protein of unknown function DUF159; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   ACR, COG2135"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50252"
FT                   /db_xref="GOA:E6SL50"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL50"
FT                   /protein_id="ADU50252.1"
FT                   /translation="MCGRFTLTTPAVELERRFLVDLQDRHVPRYNVAPGQEVLAVVEAG
FT                   GKRQPTRLRWGFVPSWAKDAKPGPINARAETAATRPMFRQALRRRRCLILADGFYEWMQ
FT                   RERGRQPVLFRLRDGAPFALAGLYERWDGPGGPLWTCCVLTTRPNALVAQVHDRMPVIL
FT                   RPGWEAAWLDPQVPPEQLAPAWEPYPATAMVAYPVSTRVNSPRYDDPACVAPVAPPLPL
FT                   PEAGGGDERA"
     MCGRFTLTTP AVELERRFLV DLQDRHVPRY NVAPGQEVLA VVEAGGKRQP TRLRWGFVPS        60
     WAKDAKPGPI NARAETAATR PMFRQALRRR RCLILADGFY EWMQRERGRQ PVLFRLRDGA       120
     PFALAGLYER WDGPGGPLWT CCVLTTRPNA LVAQVHDRMP VILRPGWEAA WLDPQVPPEQ       180
     LAPAWEPYPA TAMVAYPVST RVNSPRYDDP ACVAPVAPPL PLPEAGGGDE RA               232
//

If you have problems or comments...

PBIL Back to PBIL home page