(data stored in ACNUC30630 zone)

EMBL: CP002344.PE129

CP002344.PE129       Location/Qualifiers
FT   CDS             133443..133928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_5754 ROK family protein; SPTR: ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50254"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL52"
FT                   /protein_id="ADU50254.1"
FT                   /translation="MVGDGISAAMRDLAEFGWVDVPGRRLAEVIAAEARKLGVDARIVP
FT                   LSNEWYRVETYSRPHADRAWVAVRAVVTRPGGRRGRDGTGGSGGSSRGRGRWEDAETAG
FT                   VTEHLVIVDTGRVVHIFSFPPECLESARAFAETVEAEGIADPKRLDWLAGRMGGRRR"
     MVGDGISAAM RDLAEFGWVD VPGRRLAEVI AAEARKLGVD ARIVPLSNEW YRVETYSRPH        60
     ADRAWVAVRA VVTRPGGRRG RDGTGGSGGS SRGRGRWEDA ETAGVTEHLV IVDTGRVVHI       120
     FSFPPECLES ARAFAETVEA EGIADPKRLD WLAGRMGGRR R                           161
//

If you have problems or comments...

PBIL Back to PBIL home page