(data stored in ACNUC30630 zone)

EMBL: CP002344.PE136

CP002344.PE136       Location/Qualifiers
FT   CDS             146076..147572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0136"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000587: IPR000994: IPR001131: IPR001714; KEGG:
FT                   rca:Rcas_4452 peptidase M24; PFAM: peptidase M24;
FT                   creatinase; SPTR: Peptidase M24; PFAM: Metallopeptidase
FT                   family M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50261"
FT                   /db_xref="GOA:E6SLJ4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ4"
FT                   /protein_id="ADU50261.1"
FT                   /translation="MAADIGSGDGGKQGFGKVEGPGGGGGEPGAGRPHARGALRRGDVA
FT                   RAEVAARAQDAGPAAAKRATGHSPGDDGPAPQGPQVPQAARLAALQERMADAGIDLVVL
FT                   TPGTSWFYLAGMNLLGSRLSLLLVPRRGEPAWVAPLLEAERVAEAPLARALGRSAGRVC
FT                   TYADGEDPAPAVARAVALATAGLGGPPRVAAMEERVARLFEWRAASAALPGVAWQPAEP
FT                   LLVALRARKDLAEVAAIRRAAELVETALGHAMAFVQPGYRESQIAREMEKALRELGTRS
FT                   PFGIHVASGPRSAVPHAETEDRVLQPGDLVWIDVGAEVDGYAADITRTFLLPGGDPGEA
FT                   ARKAAIYRVCYLAQAAARAAARPGVRAGDVDAAARRVIEEAGYGPYFTHRTGHGLGLDV
FT                   HEAPNIAPGDATLLEPGMVFTVEPGIYLPGLGGVRIEDDMLITEDGAVSLTRSRRWFAP
FT                   GPEPVLVAGPAGSPRPAGPGPAWQPGGTGAGPGGTGEGGR"
     MAADIGSGDG GKQGFGKVEG PGGGGGEPGA GRPHARGALR RGDVARAEVA ARAQDAGPAA        60
     AKRATGHSPG DDGPAPQGPQ VPQAARLAAL QERMADAGID LVVLTPGTSW FYLAGMNLLG       120
     SRLSLLLVPR RGEPAWVAPL LEAERVAEAP LARALGRSAG RVCTYADGED PAPAVARAVA       180
     LATAGLGGPP RVAAMEERVA RLFEWRAASA ALPGVAWQPA EPLLVALRAR KDLAEVAAIR       240
     RAAELVETAL GHAMAFVQPG YRESQIAREM EKALRELGTR SPFGIHVASG PRSAVPHAET       300
     EDRVLQPGDL VWIDVGAEVD GYAADITRTF LLPGGDPGEA ARKAAIYRVC YLAQAAARAA       360
     ARPGVRAGDV DAAARRVIEE AGYGPYFTHR TGHGLGLDVH EAPNIAPGDA TLLEPGMVFT       420
     VEPGIYLPGL GGVRIEDDML ITEDGAVSLT RSRRWFAPGP EPVLVAGPAG SPRPAGPGPA       480
     WQPGGTGAGP GGTGEGGR                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page