(data stored in ACNUC30630 zone)

EMBL: CP002344.PE141

CP002344.PE141       Location/Qualifiers
FT   CDS             152887..153723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0141"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COGs: COG1521 Putative transcriptional regulator
FT                   protein; InterPro IPR004619; KEGG: hmo:HM1_0662
FT                   transcriptional activator, putative, baf family; PFAM: Bvg
FT                   accessory factor; PRIAM: Pantothenate kinase; SPTR:
FT                   Putative transcriptional acitvator, Baf family; TIGRFAM:
FT                   transcriptional activator, Baf family; PFAM: Bordetella
FT                   pertussis Bvg accessory factor family; TIGRFAM:
FT                   pantothenate kinase, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50266"
FT                   /db_xref="GOA:E6SLJ9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ9"
FT                   /protein_id="ADU50266.1"
FT                   /translation="MLLAIDIGNTHTKMSLYDGSRHVAGWRLSTNGERTADEFAVTLAA
FT                   LMQRRGLDPGQITAVAICSVVPPALVPVVAMVRRDLGLEPLILGPDTDTGMPVAYENPR
FT                   ELGADRIANAVAARAEYGAPVIVVDLGTATKWEVVSPEGVYLGGAIAPGVAISLDALVR
FT                   RAARLSRIELARPRQAIGRSTVEALRAGVLYGFAGQIDAVVERIEAELGQPAPVVATGG
FT                   LAALIAPESRRIQHVDPHLTLKGLWWIHQRLARAQDASGGQRRSPVRPSPGAEVPG"
     MLLAIDIGNT HTKMSLYDGS RHVAGWRLST NGERTADEFA VTLAALMQRR GLDPGQITAV        60
     AICSVVPPAL VPVVAMVRRD LGLEPLILGP DTDTGMPVAY ENPRELGADR IANAVAARAE       120
     YGAPVIVVDL GTATKWEVVS PEGVYLGGAI APGVAISLDA LVRRAARLSR IELARPRQAI       180
     GRSTVEALRA GVLYGFAGQI DAVVERIEAE LGQPAPVVAT GGLAALIAPE SRRIQHVDPH       240
     LTLKGLWWIH QRLARAQDAS GGQRRSPVRP SPGAEVPG                               278
//

If you have problems or comments...

PBIL Back to PBIL home page