(data stored in ACNUC30630 zone)

EMBL: CP002344.PE144

CP002344.PE144       Location/Qualifiers
FT   CDS             155894..156373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0144"
FT                   /product="transcription elongation factor GreA"
FT                   /note="COGs: COG0782 Transcription elongation factor;
FT                   InterPro IPR001437: IPR006359: IPR018151; KEGG:
FT                   bts:Btus_0109 GreA/GreB family elongation factor; PFAM:
FT                   transcription elongation factor GreA/GreB domain-containing
FT                   protein; SPTR: Transcription elongation factor; TIGRFAM:
FT                   transcription elongation factor GreA; PFAM: domain;
FT                   Transcription elongation factor, GreA/GreB, C-term;
FT                   TIGRFAM: transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50269"
FT                   /db_xref="GOA:E6SLK2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK2"
FT                   /protein_id="ADU50269.1"
FT                   /translation="MDKELLLSAEGLRKLEEELQYLKSVKRREVAQRIKQAREFGDISE
FT                   NSEYEEAKNEQAFVEGRIIELEKMLRNARIVNDEEIDPTKVNIGSTVHLKDVDTGEEVQ
FT                   YTIVGSNEADPAALRISYQSPVGKALFGRSVGEVVEVKVPAGTLRYEIVRIERAG"
     MDKELLLSAE GLRKLEEELQ YLKSVKRREV AQRIKQAREF GDISENSEYE EAKNEQAFVE        60
     GRIIELEKML RNARIVNDEE IDPTKVNIGS TVHLKDVDTG EEVQYTIVGS NEADPAALRI       120
     SYQSPVGKAL FGRSVGEVVE VKVPAGTLRY EIVRIERAG                              159
//

If you have problems or comments...

PBIL Back to PBIL home page