(data stored in ACNUC30630 zone)

EMBL: CP002344.PE146

CP002344.PE146       Location/Qualifiers
FT   CDS             164109..164942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0146"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="COGs: COG0572 Uridine kinase; InterPro IPR000764:
FT                   IPR017975; KEGG: gwc:GWCH70_2482 uridine kinase; SPTR:
FT                   Uridine kinase; TIGRFAM: uridine kinase; PFAM:
FT                   Phosphoribulokinase / Uridine kinase family; TIGRFAM:
FT                   uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50271"
FT                   /db_xref="GOA:E6SLK4"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK4"
FT                   /protein_id="ADU50271.1"
FT                   /translation="MAPVVIGIAGGTGSGKSTLVRRIVEHLPGRVAVLPQDAYYLDRRD
FT                   LPFEERARLNYDHPLAFDTPLLIRHLQALKQGKPVRRPVYDFTQHLRDRRTVWVEPRDV
FT                   IVVEGILVLAEEALRPLLDIKIFVDTDADVRILRRLVRDIEKRGRTLESVISQYLETVK
FT                   PMHEQFVEPSKRYADLIIPEGGFNRVAVDVLLARIRAALQNEATLRPATSPTSAADPGA
FT                   AAGSPGAVNGASASPSGGGTGAPSDGGTGGRRQRRRQRRKNRKVRPAVNQAAAEP"
     MAPVVIGIAG GTGSGKSTLV RRIVEHLPGR VAVLPQDAYY LDRRDLPFEE RARLNYDHPL        60
     AFDTPLLIRH LQALKQGKPV RRPVYDFTQH LRDRRTVWVE PRDVIVVEGI LVLAEEALRP       120
     LLDIKIFVDT DADVRILRRL VRDIEKRGRT LESVISQYLE TVKPMHEQFV EPSKRYADLI       180
     IPEGGFNRVA VDVLLARIRA ALQNEATLRP ATSPTSAADP GAAAGSPGAV NGASASPSGG       240
     GTGAPSDGGT GGRRQRRRQR RKNRKVRPAV NQAAAEP                                277
//

If you have problems or comments...

PBIL Back to PBIL home page