(data stored in ACNUC30630 zone)

EMBL: CP002344.PE158

CP002344.PE158       Location/Qualifiers
FT   CDS             181187..182305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0158"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /note="COGs: COG0698 Ribose 5-phosphate isomerase RpiB;
FT                   InterPro IPR017867: IPR003500: IPR004785: IPR000106; KEGG:
FT                   hor:Hore_17930 ribose-5-phosphate isomerase; PFAM:
FT                   Ribose/galactose isomerase; Protein-tyrosine phosphatase,
FT                   low molecular weight; SMART: Protein-tyrosine phosphatase,
FT                   low molecular weight; SPTR: Ribose-5-phosphate isomerase;
FT                   TIGRFAM: ribose 5-phosphate isomerase B; sugar-phosphate
FT                   isomerase, RpiB/LacA/LacB family; PFAM: Low molecular
FT                   weight phosphotyrosine protein phosphatase;
FT                   Ribose/Galactose Isomerase; TIGRFAM: ribose 5-phosphate
FT                   isomerase B; sugar-phosphate isomerases, RpiB/LacA/LacB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50283"
FT                   /db_xref="GOA:E6SLL6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL6"
FT                   /protein_id="ADU50283.1"
FT                   /translation="MTIRTVLVVCSGNTCRSPMAAAYLQQALAEAGAPGVRVESAGLHA
FT                   VPGVPAAAEAREAVARDGLSLAAHRSRALDEATATGADLILAMTRAQAEELRRRFPAVA
FT                   DRVALWREWAAGTPLADPDVADPFGQGLGDYQILARQLRREAAMAARRIAAAGGTPYED
FT                   GGAAPPAVAGGTPAPDSGTDTKTKEERPMDRADAAGAAVPAAGRPLRVAIGSDHAGFDL
FT                   KRDLIAFMEERGIQVIDVGTHSRESCDYPDYARAACAKVVEGEADRAVLICGTGIGMAI
FT                   AANKMPGIRAACCTEPYSARLTRQDNDSNVLTLGARVVGAGMAREILATWLETPFAGGR
FT                   HQRRIDKITHMEHEFMQQRPARNRAAAGQGQG"
     MTIRTVLVVC SGNTCRSPMA AAYLQQALAE AGAPGVRVES AGLHAVPGVP AAAEAREAVA        60
     RDGLSLAAHR SRALDEATAT GADLILAMTR AQAEELRRRF PAVADRVALW REWAAGTPLA       120
     DPDVADPFGQ GLGDYQILAR QLRREAAMAA RRIAAAGGTP YEDGGAAPPA VAGGTPAPDS       180
     GTDTKTKEER PMDRADAAGA AVPAAGRPLR VAIGSDHAGF DLKRDLIAFM EERGIQVIDV       240
     GTHSRESCDY PDYARAACAK VVEGEADRAV LICGTGIGMA IAANKMPGIR AACCTEPYSA       300
     RLTRQDNDSN VLTLGARVVG AGMAREILAT WLETPFAGGR HQRRIDKITH MEHEFMQQRP       360
     ARNRAAAGQG QG                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page