(data stored in ACNUC30630 zone)

EMBL: CP002344.PE163

CP002344.PE163       Location/Qualifiers
FT   CDS             186145..186903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0163"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="COGs: COG0356 F0F1-type ATP synthase subunit a;
FT                   InterPro IPR000568; KEGG: tjr:TherJR_2893 ATP synthase F0,
FT                   A subunit; PFAM: H+transporting two-sector ATPase A
FT                   subunit; SPTR: ATP synthase subunit a; TIGRFAM: ATP
FT                   synthase F0, A subunit; PFAM: ATP synthase A chain;
FT                   TIGRFAM: ATP synthase subunit 6 (eukaryotes),also subunit A
FT                   (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50288"
FT                   /db_xref="GOA:E6SLM1"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM1"
FT                   /protein_id="ADU50288.1"
FT                   /translation="MTPWLQLAAVGGEAAEGGQGAEEGAHVVFHLFGLPVHESIVTMWI
FT                   LMGLIILLGVLVARNLHQVPRTRFQTAVEWVVDSLYGFVTDIMGRERARRFTPLLGSFF
FT                   VLILFSNYSGLLPVLPHENWFQPPTSRWGVTGGLAVFSFVAVQAYGLARHGLGYFRRFL
FT                   EGPVFLWPLTVPLAVIEELIKPFSLSLRLFANIFGGEAVLAGLLAALPWFLPMGVMFIE
FT                   IIAGFVQALIFTMLSALYIEAATADFHHEH"
     MTPWLQLAAV GGEAAEGGQG AEEGAHVVFH LFGLPVHESI VTMWILMGLI ILLGVLVARN        60
     LHQVPRTRFQ TAVEWVVDSL YGFVTDIMGR ERARRFTPLL GSFFVLILFS NYSGLLPVLP       120
     HENWFQPPTS RWGVTGGLAV FSFVAVQAYG LARHGLGYFR RFLEGPVFLW PLTVPLAVIE       180
     ELIKPFSLSL RLFANIFGGE AVLAGLLAAL PWFLPMGVMF IEIIAGFVQA LIFTMLSALY       240
     IEAATADFHH EH                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page