(data stored in ACNUC30630 zone)

EMBL: CP002344.PE166

CP002344.PE166       Location/Qualifiers
FT   CDS             187938..188489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0166"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="COGs: COG0712 F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein); InterPro
FT                   IPR000711; KEGG: rmr:Rmar_0314 ATP synthase F1, delta
FT                   subunit; PFAM: H+transporting two-sector ATPase delta
FT                   (OSCP) subunit; SPTR: ATP synthase subunit delta; TIGRFAM:
FT                   ATP synthase F1, delta subunit; PFAM: ATP synthase delta
FT                   (OSCP) subunit; TIGRFAM: ATP synthase, F1 delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50291"
FT                   /db_xref="GOA:E6SLM4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM4"
FT                   /protein_id="ADU50291.1"
FT                   /translation="MKRRPLAQRYARVLYDLGRESSELDRLAADLARVLDVFSEHPELR
FT                   QRFESLAVPAREKHELIESVFGDRVHRWVGNLLRLLVRRRREALLPDIVAEFAALRDRE
FT                   AGVLEAEVEAAAELDAATRQRLEEELARTLGARQVRLAVRVRPELLGGLVVKIGDRRLD
FT                   ASLRRRLVQLHRQLATGGRG"
     MKRRPLAQRY ARVLYDLGRE SSELDRLAAD LARVLDVFSE HPELRQRFES LAVPAREKHE        60
     LIESVFGDRV HRWVGNLLRL LVRRRREALL PDIVAEFAAL RDREAGVLEA EVEAAAELDA       120
     ATRQRLEEEL ARTLGARQVR LAVRVRPELL GGLVVKIGDR RLDASLRRRL VQLHRQLATG       180
     GRG                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page