(data stored in ACNUC30630 zone)

EMBL: CP002344.PE168

CP002344.PE168       Location/Qualifiers
FT   CDS             190103..190990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0168"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /note="COGs: COG0224 F0F1-type ATP synthase gamma subunit;
FT                   InterPro IPR000131: IPR013838; KEGG: mta:Moth_2379 F0F1 ATP
FT                   synthase subunit gamma; PFAM: H+transporting two-sector
FT                   ATPase gamma subunit; SPTR: ATP synthase gamma chain;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM: ATP
FT                   synthase; TIGRFAM: ATP synthase, F1 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50293"
FT                   /db_xref="GOA:E6SLM6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM6"
FT                   /protein_id="ADU50293.1"
FT                   /translation="MRDIRRRIRAVRSTQQITRAMYMVAAAKLKKAEEAARSGRPYAAA
FT                   LRAMLARLAGSEQARQHPLVAPRPVERVGLVIITGDRGLAGSYNANLIRRAEQELRQLP
FT                   DGVEPVLVAVGRKGRDHFRRRGYRLAHELTGIGEDVDFATARDLARWLVDRYLAGEVDE
FT                   VRLVYTEYRSAISQRPVVTRLLPVAGLDEPAGGAAAGADAAGPRGVREYIYEPSERAIL
FT                   EALLPKYVQILVFRALQEAKASEHGARMTAMKNATDNAGELIETLTLEYNRARQAAITK
FT                   ELAEIVSGAEALKS"
     MRDIRRRIRA VRSTQQITRA MYMVAAAKLK KAEEAARSGR PYAAALRAML ARLAGSEQAR        60
     QHPLVAPRPV ERVGLVIITG DRGLAGSYNA NLIRRAEQEL RQLPDGVEPV LVAVGRKGRD       120
     HFRRRGYRLA HELTGIGEDV DFATARDLAR WLVDRYLAGE VDEVRLVYTE YRSAISQRPV       180
     VTRLLPVAGL DEPAGGAAAG ADAAGPRGVR EYIYEPSERA ILEALLPKYV QILVFRALQE       240
     AKASEHGARM TAMKNATDNA GELIETLTLE YNRARQAAIT KELAEIVSGA EALKS            295
//

If you have problems or comments...

PBIL Back to PBIL home page