(data stored in ACNUC30630 zone)

EMBL: CP002344.PE172

CP002344.PE172       Location/Qualifiers
FT   CDS             194828..195838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0172"
FT                   /product="stage II sporulation protein D"
FT                   /note="COGs: COG2385 Sporulation protein and related
FT                   protein; InterPro IPR013693: IPR014225: IPR013486; KEGG:
FT                   mta:Moth_2374 sporulation protein and related proteins;
FT                   PFAM: Stage II sporulation protein D; SPTR: Sporulation
FT                   protein and related proteins; TIGRFAM: stage II sporulation
FT                   protein D; SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation protein; TIGRFAM: SpoIID/LytB domain; stage II
FT                   sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50297"
FT                   /db_xref="GOA:E6SLN0"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN0"
FT                   /protein_id="ADU50297.1"
FT                   /translation="MPVLPAWRRPVAGWVLLALVLTVLLPFLVVVTRGWRLEVPEAPPV
FT                   PLDPGQLPVRVWVPGADAVQVLPLEVYLTGVVAAEMPASFHPEALKAQAVAARTYTVRH
FT                   MQVFGGPGCPEHPDADVCGDPQSGQAWRPLEARRREWGLFNGWRLTRKIQQAVADTAGL
FT                   ILVYQGAPIDAVYHSTSGGRTEAAAAVWGNEVPYLRPVDSPWETSSPHWRTTWEIPLAE
FT                   FARRLEVDPKAVRDLPGDQCFARIEPSPGGRVGRAVLGEKSYTGPQLRQRLDLPSTWWT
FT                   CRRQGDQVVFEVRGWGHGVGMSQYGADGMARQGRTFQEILQHYYPGTSLRPIFSE"
     MPVLPAWRRP VAGWVLLALV LTVLLPFLVV VTRGWRLEVP EAPPVPLDPG QLPVRVWVPG        60
     ADAVQVLPLE VYLTGVVAAE MPASFHPEAL KAQAVAARTY TVRHMQVFGG PGCPEHPDAD       120
     VCGDPQSGQA WRPLEARRRE WGLFNGWRLT RKIQQAVADT AGLILVYQGA PIDAVYHSTS       180
     GGRTEAAAAV WGNEVPYLRP VDSPWETSSP HWRTTWEIPL AEFARRLEVD PKAVRDLPGD       240
     QCFARIEPSP GGRVGRAVLG EKSYTGPQLR QRLDLPSTWW TCRRQGDQVV FEVRGWGHGV       300
     GMSQYGADGM ARQGRTFQEI LQHYYPGTSL RPIFSE                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page