(data stored in ACNUC30630 zone)

EMBL: CP002344.PE18

CP002344.PE18        Location/Qualifiers
FT   CDS             19595..19948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0671 peptidase A24A domain protein;
FT                   SPTR: Peptidase A24A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50143"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF6"
FT                   /protein_id="ADU50143.1"
FT                   /translation="MRDVVIRIGGRRYRYVGRRKKIERTPAPAERITAIGGRCPRCGSE
FT                   WLRGDGDPVIRYRTTRYPVWCERCGARAVMAWPTSPALRDLYCAERVGVDVATFRRYRD
FT                   AARKLWEDDRHGA"
     MRDVVIRIGG RRYRYVGRRK KIERTPAPAE RITAIGGRCP RCGSEWLRGD GDPVIRYRTT        60
     RYPVWCERCG ARAVMAWPTS PALRDLYCAE RVGVDVATFR RYRDAARKLW EDDRHGA          117
//

If you have problems or comments...

PBIL Back to PBIL home page