(data stored in ACNUC30630 zone)

EMBL: CP002344.PE180

CP002344.PE180       Location/Qualifiers
FT   CDS             203208..204464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0180"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="COGs: COG1098 RNA binding protein (contains
FT                   ribosomal protein S1 domain); InterPro IPR003029; KEGG:
FT                   rba:RB10524 putative RNA-binding protein; PFAM: RNA binding
FT                   S1 domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50305"
FT                   /db_xref="GOA:E6SLN8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN8"
FT                   /protein_id="ADU50305.1"
FT                   /translation="MSDGLKDSLLPGEDSPAPAPGGPSPVVEPVLPATTAADEPAGGRP
FT                   ARPAAEGRAGGSPPVPARRGVGPAEGTTAGTPYGYRSGLHRPASAFPRRTGGSGNESGT
FT                   RTGAGAGTGAGAAPGAGSGSAAGAAAGSGAEVRDLAGLVPLSPGTRVHGTITGIVGYGA
FT                   FLVTDDGRRGLIHISEISDWYVERAEDYFYKGERVQVEVVHFDPNSGKYAFSTRRLGGK
FT                   QPLANRYADRLLELHRHGIIRSGYKGWAREPGRWPWRGERRGGTGTASTPGPSGTAATG
FT                   SPGRTNRPAGRNKPGSRPAAGALAGTGQGAGPVGPGSRPGGSRDGTGQPAAGASQTPGA
FT                   RTAGPAAVQDDTDLLQLLRRHVGQVSPAARAELDRLVQAYGIARVGLVLAQVLEGMDRS
FT                   LQVVEAAGKRLAAGAGASA"
     MSDGLKDSLL PGEDSPAPAP GGPSPVVEPV LPATTAADEP AGGRPARPAA EGRAGGSPPV        60
     PARRGVGPAE GTTAGTPYGY RSGLHRPASA FPRRTGGSGN ESGTRTGAGA GTGAGAAPGA       120
     GSGSAAGAAA GSGAEVRDLA GLVPLSPGTR VHGTITGIVG YGAFLVTDDG RRGLIHISEI       180
     SDWYVERAED YFYKGERVQV EVVHFDPNSG KYAFSTRRLG GKQPLANRYA DRLLELHRHG       240
     IIRSGYKGWA REPGRWPWRG ERRGGTGTAS TPGPSGTAAT GSPGRTNRPA GRNKPGSRPA       300
     AGALAGTGQG AGPVGPGSRP GGSRDGTGQP AAGASQTPGA RTAGPAAVQD DTDLLQLLRR       360
     HVGQVSPAAR AELDRLVQAY GIARVGLVLA QVLEGMDRSL QVVEAAGKRL AAGAGASA         418
//

If you have problems or comments...

PBIL Back to PBIL home page