(data stored in ACNUC30630 zone)

EMBL: CP002344.PE183

CP002344.PE183       Location/Qualifiers
FT   CDS             206277..207734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0183"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR001029; KEGG: cbk:CLL_A3427
FT                   flagellin; PFAM: flagellin domain protein; SPTR: Flagellin;
FT                   PFAM: Bacterial flagellin N-terminal helical region;
FT                   Bacterial flagellin C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50308"
FT                   /db_xref="GOA:E6SLP1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP1"
FT                   /protein_id="ADU50308.1"
FT                   /translation="MFMRINHNVAALNAWRNLSQTNSLLNKSLERLSSGLRINRAADDA
FT                   AGLAISEKMRAQIAGLQTAQRNAQDAISLIQTAEGALNETHSILQRMRELAVQASNDSM
FT                   TDADRANLQKEVEQLIAELDRIGNTTEFNTKKLLDGSAGVSTAIASGKALNVSATGDTQ
FT                   AGSYTIDIKAAATRGEVWLAQADDATSTFWTTFSDVNATLVKDLDITVNGRRYFFAAGT
FT                   KVQDVIDTVNADSALTGVEADFNANAIRFRTTDVGSARQVSVTINSNTTFFNVANASTG
FT                   ATSDVNAATVAGTDAELGSLGVNGTPVNYEAVGNRITILSGPAKGLSFTVDASGTYTGG
FT                   SNADDDPTITVGTNGALTFQIGANTGQSLSVAIDDMRSQALGVKTVDVSTRSGASNAIS
FT                   AIDSAINTVSVQRARLGAVQNRLEHTIANLGVAVENLQAAESRIRDVDMALEMANFTRN
FT                   QILLQSGTAMLAQANAMPQAVLQLLGR"
     MFMRINHNVA ALNAWRNLSQ TNSLLNKSLE RLSSGLRINR AADDAAGLAI SEKMRAQIAG        60
     LQTAQRNAQD AISLIQTAEG ALNETHSILQ RMRELAVQAS NDSMTDADRA NLQKEVEQLI       120
     AELDRIGNTT EFNTKKLLDG SAGVSTAIAS GKALNVSATG DTQAGSYTID IKAAATRGEV       180
     WLAQADDATS TFWTTFSDVN ATLVKDLDIT VNGRRYFFAA GTKVQDVIDT VNADSALTGV       240
     EADFNANAIR FRTTDVGSAR QVSVTINSNT TFFNVANAST GATSDVNAAT VAGTDAELGS       300
     LGVNGTPVNY EAVGNRITIL SGPAKGLSFT VDASGTYTGG SNADDDPTIT VGTNGALTFQ       360
     IGANTGQSLS VAIDDMRSQA LGVKTVDVST RSGASNAISA IDSAINTVSV QRARLGAVQN       420
     RLEHTIANLG VAVENLQAAE SRIRDVDMAL EMANFTRNQI LLQSGTAMLA QANAMPQAVL       480
     QLLGR                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page