(data stored in ACNUC30630 zone)

EMBL: CP002344.PE188

CP002344.PE188       Location/Qualifiers
FT   CDS             212089..213336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0188"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: chy:CHY_0138 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase; PRIAM:
FT                   Methionine adenosyltransferase; SPTR: S-adenosylmethionine
FT                   synthase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase, C-terminal domain;
FT                   S-adenosylmethionine synthetase, central domain;
FT                   S-adenosylmethionine synthetase, N-terminal domain;
FT                   TIGRFAM: S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50313"
FT                   /db_xref="GOA:E6SLP6"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP6"
FT                   /protein_id="ADU50313.1"
FT                   /translation="MTRAKGRHLFTSESVTEGHPDKIADQISDAVLDAILEQDPQARVA
FT                   CETAVTTGMVLVMGEISTTCYVHIPALVRDVLREIGYTRAKYGFDADTCSVLTAIDEQS
FT                   PDIAQGVLDAWEVRHGQAPADEFSRIGAGDQGMMFGFACRETRELMPLPITLAHRLTRR
FT                   LAEVRKSGLLPYLRPDGKAQVTVEYEGTRPVRVDAIVVSTQHRDDIARAQLEEDIRRHV
FT                   IGAVVPAHMLDEKTRIFINPTGRFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGK
FT                   DPTKVDRSGAYAARWVAKNIVAAGLAERCEIQVAYAIGVAQPVSIRVDTFGTGLIPDDR
FT                   IEELVRQHFDLRPGAIIHTLNLRRPIYRQVAAYGHFGRPELDLPWERIDRAAELRAAAD
FT                   LGPMPADPLAEVAVTL"
     MTRAKGRHLF TSESVTEGHP DKIADQISDA VLDAILEQDP QARVACETAV TTGMVLVMGE        60
     ISTTCYVHIP ALVRDVLREI GYTRAKYGFD ADTCSVLTAI DEQSPDIAQG VLDAWEVRHG       120
     QAPADEFSRI GAGDQGMMFG FACRETRELM PLPITLAHRL TRRLAEVRKS GLLPYLRPDG       180
     KAQVTVEYEG TRPVRVDAIV VSTQHRDDIA RAQLEEDIRR HVIGAVVPAH MLDEKTRIFI       240
     NPTGRFVVGG PQGDAGLTGR KIIVDTYGGY ARHGGGAFSG KDPTKVDRSG AYAARWVAKN       300
     IVAAGLAERC EIQVAYAIGV AQPVSIRVDT FGTGLIPDDR IEELVRQHFD LRPGAIIHTL       360
     NLRRPIYRQV AAYGHFGRPE LDLPWERIDR AAELRAAADL GPMPADPLAE VAVTL            415
//

If you have problems or comments...

PBIL Back to PBIL home page