(data stored in ACNUC30630 zone)

EMBL: CP002344.PE192

CP002344.PE192       Location/Qualifiers
FT   CDS             217503..218030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0192"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="InterPro IPR007412; KEGG: dre:562496 collagen type
FT                   II, alpha-1a; PFAM: Anti-sigma-28 factor FlgM family
FT                   protein; SPTR: Collagen type II, alpha 1; TIGRFAM:
FT                   Anti-sigma-28 factor FlgM family protein; PFAM:
FT                   Anti-sigma-28 factor, FlgM; TIGRFAM: flagellar biosynthesis
FT                   anti-sigma factor FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50317"
FT                   /db_xref="GOA:E6SLQ0"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ0"
FT                   /protein_id="ADU50317.1"
FT                   /translation="MIISRQQVVNALKAYGMLPGPGVPGNAPGPVPPAGPTVPPGPGAA
FT                   GGERGEPHTPGPVATSVGSGSPSGRPGAVAGTSPAGGAAGAAGVAGSSGAGGAGGLQGP
FT                   VTAPRDRVDLSPEAAAIRRLVEEARRLPDVRPERVAALRQQIARGEYAVDPEQVAERML
FT                   YRLLADRAQEGR"
     MIISRQQVVN ALKAYGMLPG PGVPGNAPGP VPPAGPTVPP GPGAAGGERG EPHTPGPVAT        60
     SVGSGSPSGR PGAVAGTSPA GGAAGAAGVA GSSGAGGAGG LQGPVTAPRD RVDLSPEAAA       120
     IRRLVEEARR LPDVRPERVA ALRQQIARGE YAVDPEQVAE RMLYRLLADR AQEGR            175
//

If you have problems or comments...

PBIL Back to PBIL home page