(data stored in ACNUC30630 zone)

EMBL: CP002344.PE194

CP002344.PE194       Location/Qualifiers
FT   CDS             218696..220258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0194"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="COGs: COG1256 Flagellar hook-associated protein;
FT                   InterPro IPR001444: IPR010930: IPR002371: IPR017975; KEGG:
FT                   tjr:TherJR_2798 flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; SPTR: Flagellar
FT                   hook-associated protein FlgK; TIGRFAM: flagellar
FT                   hook-associated protein FlgK; PFAM: Flagella basal body rod
FT                   protein; Domain of unknown function (DUF1078); TIGRFAM:
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50319"
FT                   /db_xref="GOA:E6SLQ2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ2"
FT                   /protein_id="ADU50319.1"
FT                   /translation="MRSTFFGLELARLGLWAQQRALDVTGHNIANANTEGYSRQVARLS
FT                   PTPAYAPPSLAMAAEAGQVGTGVQVAEIQRVRDLFLDRQARDLKAHLGRWQVRSQTLAE
FT                   LETILGEPSDAGLARALADFWDALATVANRPDSLPARTAAIQQAHTLLERFQTADRQLA
FT                   DLADNLDASLVARVDRVNQILVQMADLHRRIRVATAAGQTPNDLLDERDRLLEELGTLL
FT                   PVRVTERPDGTVRVEVAGLPLVDGQVVHRLAVQEEPAGGAGGGGTGSGTSGGLVVRIYW
FT                   DGTATVPASATPQAVSGPGASGGAAAAFIPLDDTVLDGGEIDGLLEARDRLVAGLRQDL
FT                   KALFFALADAVNAVHRQGYGLNDGPPAGSGQQGAGRDLFVVGSGSDLQQVVVNPELDDP
FT                   ANLAAAQMPGAPGDGRNALAMVQLRHAPLNLPGSPSAQDYLESVVAGLGIAGRQAEEGQ
FT                   RTAQLLLDQVAAQRESVRGVSLDEEMTQLIRYQHAYAAAARLVTAVDTMLGILIERTGV
FT                   VGR"
     MRSTFFGLEL ARLGLWAQQR ALDVTGHNIA NANTEGYSRQ VARLSPTPAY APPSLAMAAE        60
     AGQVGTGVQV AEIQRVRDLF LDRQARDLKA HLGRWQVRSQ TLAELETILG EPSDAGLARA       120
     LADFWDALAT VANRPDSLPA RTAAIQQAHT LLERFQTADR QLADLADNLD ASLVARVDRV       180
     NQILVQMADL HRRIRVATAA GQTPNDLLDE RDRLLEELGT LLPVRVTERP DGTVRVEVAG       240
     LPLVDGQVVH RLAVQEEPAG GAGGGGTGSG TSGGLVVRIY WDGTATVPAS ATPQAVSGPG       300
     ASGGAAAAFI PLDDTVLDGG EIDGLLEARD RLVAGLRQDL KALFFALADA VNAVHRQGYG       360
     LNDGPPAGSG QQGAGRDLFV VGSGSDLQQV VVNPELDDPA NLAAAQMPGA PGDGRNALAM       420
     VQLRHAPLNL PGSPSAQDYL ESVVAGLGIA GRQAEEGQRT AQLLLDQVAA QRESVRGVSL       480
     DEEMTQLIRY QHAYAAAARL VTAVDTMLGI LIERTGVVGR                             520
//

If you have problems or comments...

PBIL Back to PBIL home page