(data stored in ACNUC30630 zone)

EMBL: CP002344.PE2

CP002344.PE2         Location/Qualifiers
FT   CDS             2217..3326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: sth:STH2 DNA
FT                   polymerase III beta subunit; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50127"
FT                   /db_xref="GOA:E6SK03"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK03"
FT                   /protein_id="ADU50127.1"
FT                   /translation="MRLVIDQSDLHAALQVAIRGVATRSTLPVLSGILLVAEPEQLRLV
FT                   ATDMEMTVEVLAPARVQEEGSVVLPGRHLVEIVRRLPPGEVHLEVEGFRARILQERSRF
FT                   TIHGTDPGIFPAMPHISAGSTVLFDNGLLRNVLRRTTFAVSTDEGRPILTGVSFRAEGD
FT                   RLQAVATDGFRIAACSVTLERPVEGQPVAAVIPGRSLAEVARLLPDQGIGRLLLDETQA
FT                   GFQLGEVRLITRLVDGVYPDVLGLVPSEYPTRVQLPTRAFQEACERAALLADTRQPARW
FT                   VIRLAVEPGRLVITASDPELGEAREEIPAQVDGEGMVIGFNARYLVDGLKAIDTEEVLF
FT                   ELTEPLKASRLRGVGADDFTYIVLPVKIS"
     MRLVIDQSDL HAALQVAIRG VATRSTLPVL SGILLVAEPE QLRLVATDME MTVEVLAPAR        60
     VQEEGSVVLP GRHLVEIVRR LPPGEVHLEV EGFRARILQE RSRFTIHGTD PGIFPAMPHI       120
     SAGSTVLFDN GLLRNVLRRT TFAVSTDEGR PILTGVSFRA EGDRLQAVAT DGFRIAACSV       180
     TLERPVEGQP VAAVIPGRSL AEVARLLPDQ GIGRLLLDET QAGFQLGEVR LITRLVDGVY       240
     PDVLGLVPSE YPTRVQLPTR AFQEACERAA LLADTRQPAR WVIRLAVEPG RLVITASDPE       300
     LGEAREEIPA QVDGEGMVIG FNARYLVDGL KAIDTEEVLF ELTEPLKASR LRGVGADDFT       360
     YIVLPVKIS                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page