(data stored in ACNUC30630 zone)

EMBL: CP002344.PE207

CP002344.PE207       Location/Qualifiers
FT   CDS             237302..238570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0207"
FT                   /product="serine protease"
FT                   /note="InterPro IPR001478; KEGG: pth:PTH_2743 serine
FT                   protease; SPTR: Trypsin-like serine protease, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50332"
FT                   /db_xref="GOA:E6SM02"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM02"
FT                   /protein_id="ADU50332.1"
FT                   /translation="MNGPWGLPLGELARLLVFDTLPATVLSPSTAPLFVLVLGLVAFQY
FT                   ARIGRMELEMYGRTLVPTWHRVLTAVAAGLLGGFVGGLIMTAAGVVLEPRDVTPLWPVA
FT                   LVLALIRPRFICFAYATGIIGASTLLWGWPQVHVPGLVALVGVLHLAEAILVYIDGAEG
FT                   ATPVLARNGRGEVVGGYLMQRFWPVPAAILVLINFTSPGGGIEMPPWWPLVGPADPERL
FT                   QAAGWIVAALPLVAGLGYTDVALTATPGARSRRMALIMVAYGAALVGLAALAERDAAWL
FT                   WPATLASPLLHEGMIQLGLARERWGRPLFGPAEQGARVFWVWPGSQAEALGLQAGDIIL
FT                   AANGRPVQREGDLVSVAMDLWEGRPRIYDLRLEVQRGGRRVTLELARFDPMRPFGAVLV
FT                   PPPGDPAPRPVVDLGRGKHLFGT"
     MNGPWGLPLG ELARLLVFDT LPATVLSPST APLFVLVLGL VAFQYARIGR MELEMYGRTL        60
     VPTWHRVLTA VAAGLLGGFV GGLIMTAAGV VLEPRDVTPL WPVALVLALI RPRFICFAYA       120
     TGIIGASTLL WGWPQVHVPG LVALVGVLHL AEAILVYIDG AEGATPVLAR NGRGEVVGGY       180
     LMQRFWPVPA AILVLINFTS PGGGIEMPPW WPLVGPADPE RLQAAGWIVA ALPLVAGLGY       240
     TDVALTATPG ARSRRMALIM VAYGAALVGL AALAERDAAW LWPATLASPL LHEGMIQLGL       300
     ARERWGRPLF GPAEQGARVF WVWPGSQAEA LGLQAGDIIL AANGRPVQRE GDLVSVAMDL       360
     WEGRPRIYDL RLEVQRGGRR VTLELARFDP MRPFGAVLVP PPGDPAPRPV VDLGRGKHLF       420
     GT                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page