(data stored in ACNUC30630 zone)

EMBL: CP002344.PE208

CP002344.PE208       Location/Qualifiers
FT   CDS             238716..240797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0208"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="COGs: COG0556 Helicase subunit of the DNA excision
FT                   repair complex; InterPro IPR014001: IPR001650: IPR006935:
FT                   IPR001943: IPR 004807: IPR014021; KEGG: mta:Moth_0251
FT                   excinuclease ABC subunit B; PFAM: helicase domain protein;
FT                   type III restriction protein res subunit; UvrB/UvrC
FT                   protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; SPTR: UvrABC system protein B; TIGRFAM:
FT                   excinuclease ABC, B subunit; PFAM: Helicase conserved
FT                   C-terminal domain; UvrB/uvrC motif; Type III restriction
FT                   enzyme, res subunit; Ultra-violet resistance protein B;
FT                   TIGRFAM: excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50333"
FT                   /db_xref="GOA:E6SM03"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM03"
FT                   /protein_id="ADU50333.1"
FT                   /translation="MPAFKVVSEFEPRGDQPKAIAEITRAFREGARVVTLLGATGTGKT
FT                   ATMAWVIEQLQLPTLVIAHNKTLAGQLAAEFKQFFPHNAVEYFVSYYDYYQPEAYVPQT
FT                   DTYIEKDALINDEIDKLRHSATSSLFERKDVIVVASVSCIYGLGAPEDYRDLVLSLRVG
FT                   NEMPREQILRKLVDIQYTRNDVDFQRGTFRVRGDVIEIFPASMAERAIRVELFGDEIDR
FT                   LTEIDALTGEVLAYRDHVAIYPASHYVTHEWKLKRAIESIERELEERLAELRAQDKLLE
FT                   AQRLEQRTRYDLEMLREVGYCSGIENYSRHLTGRAPGEPPYTLLDYFPRPFLCIIDESH
FT                   VTIPQLRAMYEGEMSRKDSLIDYGFRLPSARDNRPLKFDEFWEKVGQVLFVSATPGPFE
FT                   REVSDVIVEQIVRPTGLLDPEIEVRPTRGQIEDLLGEIRQRVERGHRVLVTTLTKRMAE
FT                   DLTDYLREMGIKVRYLHSEIDTLERMEIIRDLRLGVFDVLVGINLLREGLDLPEVSLVA
FT                   ILDADKEGYLRSATALIQTIGRAARNVEGKVIMYADTITDSMRQAIEETYRRRKIQEDY
FT                   NRRHGITPQTVRKAVRDVIEATHAAERPPEYLAGKRLSELPRHQIPDLVKRLRKEMEQA
FT                   ARDLEFERAALLRDMILELEARRLGQPVSREGLRAAAPAGAGSGTAGRRRARSGRAGR"
     MPAFKVVSEF EPRGDQPKAI AEITRAFREG ARVVTLLGAT GTGKTATMAW VIEQLQLPTL        60
     VIAHNKTLAG QLAAEFKQFF PHNAVEYFVS YYDYYQPEAY VPQTDTYIEK DALINDEIDK       120
     LRHSATSSLF ERKDVIVVAS VSCIYGLGAP EDYRDLVLSL RVGNEMPREQ ILRKLVDIQY       180
     TRNDVDFQRG TFRVRGDVIE IFPASMAERA IRVELFGDEI DRLTEIDALT GEVLAYRDHV       240
     AIYPASHYVT HEWKLKRAIE SIERELEERL AELRAQDKLL EAQRLEQRTR YDLEMLREVG       300
     YCSGIENYSR HLTGRAPGEP PYTLLDYFPR PFLCIIDESH VTIPQLRAMY EGEMSRKDSL       360
     IDYGFRLPSA RDNRPLKFDE FWEKVGQVLF VSATPGPFER EVSDVIVEQI VRPTGLLDPE       420
     IEVRPTRGQI EDLLGEIRQR VERGHRVLVT TLTKRMAEDL TDYLREMGIK VRYLHSEIDT       480
     LERMEIIRDL RLGVFDVLVG INLLREGLDL PEVSLVAILD ADKEGYLRSA TALIQTIGRA       540
     ARNVEGKVIM YADTITDSMR QAIEETYRRR KIQEDYNRRH GITPQTVRKA VRDVIEATHA       600
     AERPPEYLAG KRLSELPRHQ IPDLVKRLRK EMEQAARDLE FERAALLRDM ILELEARRLG       660
     QPVSREGLRA AAPAGAGSGT AGRRRARSGR AGR                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page