(data stored in ACNUC30630 zone)

EMBL: CP002344.PE230

CP002344.PE230       Location/Qualifiers
FT   CDS             269473..269751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA2917 phosphatidate
FT                   cytidylyltransferase; SPTR: Phosphatidate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50355"
FT                   /db_xref="GOA:E6SM25"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM25"
FT                   /protein_id="ADU50355.1"
FT                   /translation="MGGVLDVLILIGKVLISIAAIALGISWGVRGQMRTALAVCAVLLA
FT                   MGIFWTNLAGLLIPTILLAYMAGVLMERGWHRAGRQREENGGHATGG"
     MGGVLDVLIL IGKVLISIAA IALGISWGVR GQMRTALAVC AVLLAMGIFW TNLAGLLIPT        60
     ILLAYMAGVL MERGWHRAGR QREENGGHAT GG                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page