(data stored in ACNUC30630 zone)

EMBL: CP002344.PE241

CP002344.PE241       Location/Qualifiers
FT   CDS             284846..285718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0241"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524: IPR011663; KEGG: sgr:SGR_144 GntR family
FT                   transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain-containing protein; regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   Putative GntR-family transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50366"
FT                   /db_xref="GOA:E6SM36"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM36"
FT                   /protein_id="ADU50366.1"
FT                   /translation="MEGPQLDRTSPVPLYLQIKEWMLDQIRSGRWPQRFKLPAEEDLAG
FT                   AIGVSRGTLRKAIAALVSEGVLDQIHGKGTFVTAGGIEQPLAQRLSAFSELLEERGITY
FT                   STRVLEQALEEPASRVASLLRLEPGQRVVHLARIRLVESCPVAYMENYVPAHLAPGLER
FT                   ADFTRNGLFRTLEQEYGLRLAWGQRTFEALGAEGDVARYLDLPPGAPVFYIQQVVYLDD
FT                   GRPVEFSDVWLRGDRFRLSAVIRRSREGRGREGAGALRGPRVGPPVPGPGDAVPGGGWS
FT                   GPGAAKLSF"
     MEGPQLDRTS PVPLYLQIKE WMLDQIRSGR WPQRFKLPAE EDLAGAIGVS RGTLRKAIAA        60
     LVSEGVLDQI HGKGTFVTAG GIEQPLAQRL SAFSELLEER GITYSTRVLE QALEEPASRV       120
     ASLLRLEPGQ RVVHLARIRL VESCPVAYME NYVPAHLAPG LERADFTRNG LFRTLEQEYG       180
     LRLAWGQRTF EALGAEGDVA RYLDLPPGAP VFYIQQVVYL DDGRPVEFSD VWLRGDRFRL       240
     SAVIRRSREG RGREGAGALR GPRVGPPVPG PGDAVPGGGW SGPGAAKLSF                  290
//

If you have problems or comments...

PBIL Back to PBIL home page