(data stored in ACNUC30630 zone)

EMBL: CP002344.PE242

CP002344.PE242       Location/Qualifiers
FT   CDS             285759..286703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0242"
FT                   /product="ribokinase"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611: IPR011877: IPR002139; KEGG:
FT                   rxy:Rxyl_1888 PfkB; PFAM: PfkB domain protein; SPTR: PfkB;
FT                   TIGRFAM: ribokinase; PFAM: pfkB family carbohydrate kinase;
FT                   TIGRFAM: ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50367"
FT                   /db_xref="GOA:E6SM37"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM37"
FT                   /protein_id="ADU50367.1"
FT                   /translation="MSGHAEPRRPVVTVVGSFAVGLTLRADRFPVAGETVVGRDFDRGP
FT                   GGKGSNQAVQAARLGADVEFVGLVGDDDLAAMAWELYRREGVGTRYLGVVPGRNTGVGF
FT                   IVLNAQGENFIVLDPGANGCLGPAHVERARERLAQSHVVLTQLEIPVEAAVHALRLARD
FT                   AGVTAILNPAPARPLPLEHLALADVITPNETELRILLGLPPDDPADSLDLCHRLLAAGV
FT                   RTVVLTRGARGVLVVEPGGVVEIPAFPVAVVDTTGAGDAFSATFAVSLAEGRPLAEAAR
FT                   RAAAAGALACTALGVIPALPRRDQLDALLAARA"
     MSGHAEPRRP VVTVVGSFAV GLTLRADRFP VAGETVVGRD FDRGPGGKGS NQAVQAARLG        60
     ADVEFVGLVG DDDLAAMAWE LYRREGVGTR YLGVVPGRNT GVGFIVLNAQ GENFIVLDPG       120
     ANGCLGPAHV ERARERLAQS HVVLTQLEIP VEAAVHALRL ARDAGVTAIL NPAPARPLPL       180
     EHLALADVIT PNETELRILL GLPPDDPADS LDLCHRLLAA GVRTVVLTRG ARGVLVVEPG       240
     GVVEIPAFPV AVVDTTGAGD AFSATFAVSL AEGRPLAEAA RRAAAAGALA CTALGVIPAL       300
     PRRDQLDALL AARA                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page