(data stored in ACNUC30630 zone)

EMBL: CP002344.PE252

CP002344.PE252       Location/Qualifiers
FT   CDS             294528..295739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0252"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; InterPro IPR001763; KEGG: hha:Hhal_1932
FT                   beta-lactamase domain-containing protein; SMART: Rhodanese
FT                   domain protein; SPTR: Beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily; Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50377"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM47"
FT                   /protein_id="ADU50377.1"
FT                   /translation="MDARTRTPWEIDAGELKRMLDRGETPFLIDVRNDEEFRRWRIEGR
FT                   QPLPVIHVPYYEILAEAEEDDVTASAKAYARRYWVDHLPREGRIVVVCAHGGTSRYVAQ
FT                   GLRELGYDAFSLRGGMIAWGDHYEFVPVVEEEGLAVYQINRPARGCLSYLVASEGEAVI
FT                   IDPLRHAERYLEFSRRHGLAITRVLDTHAHADHISSGTELAEKLGVPYHLHPYDAIHPM
FT                   DVLPATFRYQPVYDGQEVRVGRATLRAIHVPGHTLGQVVYLLDDRYLFSGDTIFVESIA
FT                   RPDLGGRAETWTPLYYRSLLRLMELPDSTLVLPGHFSRPQEADARGLVAGTLGDLKQSN
FT                   EGLQALAAGERAFVDFIMARLPEFPQHYVDIKRVNTGLLRPSEEQASELELGRNVCALA
FT                   EEAA"
     MDARTRTPWE IDAGELKRML DRGETPFLID VRNDEEFRRW RIEGRQPLPV IHVPYYEILA        60
     EAEEDDVTAS AKAYARRYWV DHLPREGRIV VVCAHGGTSR YVAQGLRELG YDAFSLRGGM       120
     IAWGDHYEFV PVVEEEGLAV YQINRPARGC LSYLVASEGE AVIIDPLRHA ERYLEFSRRH       180
     GLAITRVLDT HAHADHISSG TELAEKLGVP YHLHPYDAIH PMDVLPATFR YQPVYDGQEV       240
     RVGRATLRAI HVPGHTLGQV VYLLDDRYLF SGDTIFVESI ARPDLGGRAE TWTPLYYRSL       300
     LRLMELPDST LVLPGHFSRP QEADARGLVA GTLGDLKQSN EGLQALAAGE RAFVDFIMAR       360
     LPEFPQHYVD IKRVNTGLLR PSEEQASELE LGRNVCALAE EAA                         403
//

If you have problems or comments...

PBIL Back to PBIL home page