(data stored in ACNUC30630 zone)

EMBL: CP002344.PE263

CP002344.PE263       Location/Qualifiers
FT   CDS             305161..305511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0263"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="COGs: COG2337 Growth inhibitor; InterPro IPR003477;
FT                   KEGG: chy:CHY_0716 PemK family regulatory protein; PFAM:
FT                   PemK family protein; SPTR: Regulatory protein, PemK family;
FT                   PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50388"
FT                   /db_xref="GOA:E6SM58"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM58"
FT                   /protein_id="ADU50388.1"
FT                   /translation="MEVRRGDIFFADLSPVVGSEQGGIRPVLVIQNDVGNRYSPTTIVA
FT                   AITSQINKAKLPTHVELPAGSYGLEKDSVVLLEQIRTIDKRRLLERVARLDAAAMRRVN
FT                   VALEISLGLREV"
     MEVRRGDIFF ADLSPVVGSE QGGIRPVLVI QNDVGNRYSP TTIVAAITSQ INKAKLPTHV        60
     ELPAGSYGLE KDSVVLLEQI RTIDKRRLLE RVARLDAAAM RRVNVALEIS LGLREV           116
//

If you have problems or comments...

PBIL Back to PBIL home page