(data stored in ACNUC30630 zone)

EMBL: CP002344.PE27

CP002344.PE27        Location/Qualifiers
FT   CDS             24812..25123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_0209 hypothetical protein; SPTR:
FT                   ORF18"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50152"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG5"
FT                   /protein_id="ADU50152.1"
FT                   /translation="MADPKWTPGPWELCRLSDRALAVKKAGETWGNCGIAIVLSDNREA
FT                   DGHLITAAPDMYEACEAALLAIETNPIDRFLTPEEVDAVEKLQAALRKARGEQEEGDA"
     MADPKWTPGP WELCRLSDRA LAVKKAGETW GNCGIAIVLS DNREADGHLI TAAPDMYEAC        60
     EAALLAIETN PIDRFLTPEE VDAVEKLQAA LRKARGEQEE GDA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page