(data stored in ACNUC30630 zone)

EMBL: CP002344.PE274

CP002344.PE274       Location/Qualifiers
FT   CDS             317533..318705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0274"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR020616: IPR020617: IPR002155: IPR020615: IPR 020610:
FT                   IPR020613; KEGG: bts:Btus_3277 acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase-like; PRIAM: Acetyl-CoA
FT                   C-acetyltransferase; SPTR: Acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase,
FT                   C-terminal domain; Thiolase, N-terminal domain; TIGRFAM:
FT                   acetyl-CoA acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50399"
FT                   /db_xref="GOA:E6SMD9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMD9"
FT                   /protein_id="ADU50399.1"
FT                   /translation="MIIDGARTPFGKFGGALKDVPAVELGAVAIRAALDRAGVAPEQVD
FT                   YVLMGMVVQAGAGQIPSRQAAVKAGLPVTVPSDTINKVCASALRAVNLGDALIRAGDAA
FT                   VVVAGGMESMSQAPYLARQARWGGRMGHLQLEDALLTDGLLCAFGGCHMGVYGSRVAAE
FT                   YGVTREEQDRWALRSHQRAIAAMDAGRLAEEIVPVQVPGRKGEVTRVEVDEAPRRDTSY
FT                   EKLAALPPVFEQDGTVTAGNAPGLNDGAAALVLMEAERARALGLKPLATIVSQGQASLD
FT                   PPYLHTVPYYAAERALKKAGLRWDDIALFEVNEAFAAVALTTMKLGNWDPEKVNVNGGA
FT                   VALGHPIGASGARILLTLAYELRRRGGGYGIATICSGGGQGEATLIRVDG"
     MIIDGARTPF GKFGGALKDV PAVELGAVAI RAALDRAGVA PEQVDYVLMG MVVQAGAGQI        60
     PSRQAAVKAG LPVTVPSDTI NKVCASALRA VNLGDALIRA GDAAVVVAGG MESMSQAPYL       120
     ARQARWGGRM GHLQLEDALL TDGLLCAFGG CHMGVYGSRV AAEYGVTREE QDRWALRSHQ       180
     RAIAAMDAGR LAEEIVPVQV PGRKGEVTRV EVDEAPRRDT SYEKLAALPP VFEQDGTVTA       240
     GNAPGLNDGA AALVLMEAER ARALGLKPLA TIVSQGQASL DPPYLHTVPY YAAERALKKA       300
     GLRWDDIALF EVNEAFAAVA LTTMKLGNWD PEKVNVNGGA VALGHPIGAS GARILLTLAY       360
     ELRRRGGGYG IATICSGGGQ GEATLIRVDG                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page