(data stored in ACNUC30630 zone)

EMBL: CP002344.PE281

CP002344.PE281       Location/Qualifiers
FT   CDS             complement(324278..324538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyt:cce_3903 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50406"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME6"
FT                   /protein_id="ADU50406.1"
FT                   /translation="MAEGRHPLTVRVPAELLAGIRQVQEPGESLNDFLVAAARREITRR
FT                   QALRARDTIVRLRQAIRERTGVHPDPIPLIRALREGEARDE"
     MAEGRHPLTV RVPAELLAGI RQVQEPGESL NDFLVAAARR EITRRQALRA RDTIVRLRQA        60
     IRERTGVHPD PIPLIRALRE GEARDE                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page