(data stored in ACNUC30630 zone)

EMBL: CP002344.PE289

CP002344.PE289       Location/Qualifiers
FT   CDS             337920..338891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0289"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: tte:TTE0613 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50414"
FT                   /db_xref="GOA:E6SMF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF4"
FT                   /protein_id="ADU50414.1"
FT                   /translation="MAVNRAAPPAPAPTPALTPDMFQPAPVATGEAEAIVRPSLTFWQD
FT                   AWIRFRANRLAMLGLVLLIFMALGSLLGPVISYRLLGHTFDFQDYANINKPPSAQFWFG
FT                   TDQIGRDLFTRVWMGGRISLFIGIVAALLELVIGVLYGGISGYLGGRVDEIMMRIIDVL
FT                   YGIPYLLLVILLLVVMDPGLPTIILAMGMTGWVGMARLVRGQILQLREMEFVLAARVLG
FT                   VPTMPLILRHLVPNIMGPIIVSLTLTVPGAIFGEAFLSFIGLGVPPPRASWGTLINEAY
FT                   TVMRIWPWQFAFPALALSITMFAFNAVGDGLRDALDPRLRAR"
     MAVNRAAPPA PAPTPALTPD MFQPAPVATG EAEAIVRPSL TFWQDAWIRF RANRLAMLGL        60
     VLLIFMALGS LLGPVISYRL LGHTFDFQDY ANINKPPSAQ FWFGTDQIGR DLFTRVWMGG       120
     RISLFIGIVA ALLELVIGVL YGGISGYLGG RVDEIMMRII DVLYGIPYLL LVILLLVVMD       180
     PGLPTIILAM GMTGWVGMAR LVRGQILQLR EMEFVLAARV LGVPTMPLIL RHLVPNIMGP       240
     IIVSLTLTVP GAIFGEAFLS FIGLGVPPPR ASWGTLINEA YTVMRIWPWQ FAFPALALSI       300
     TMFAFNAVGD GLRDALDPRL RAR                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page