(data stored in ACNUC30630 zone)

EMBL: CP002344.PE292

CP002344.PE292       Location/Qualifiers
FT   CDS             341367..343088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0292"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914: IPR001412; KEGG:
FT                   pjd:Pjdr2_4828 extracellular solute-binding protein family
FT                   5; PFAM: extracellular solute-binding protein family 5;
FT                   SPTR: Extracellular solute-binding protein, family 5; PFAM:
FT                   Bacterial extracellular solute-binding proteins, family 5
FT                   Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50417"
FT                   /db_xref="GOA:E6SMF7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF7"
FT                   /protein_id="ADU50417.1"
FT                   /translation="MLRKARLGTALALLLVVALVLVACGQGGGQGPAQGEGGQQQSAEG
FT                   EQSRPQKGGTLTVGTFSDIITINPLFIDDVPSQEVANLVLASLYDVDPQANVIVSDTSL
FT                   AAELPQISEDGLSYTVKLKDTPKWTDGRPVTAEDVAWTIEMYANPEVGSPAIASFDKVD
FT                   KVEVVDPQTVRVTLKQVYAPFLYTLAELQPLPKHVFEGVAPKDLQKQPYGTDPSKTVTN
FT                   GPWKWTEWTQKQYVTLERNENYWGPEPYIDRVVFKIYADQNTLAQAMLNREIDILPGVD
FT                   VKTLPALQGQSGIQIVEAPGPVYDYLGFNFKPENFPDGFVPWASQKTRQAIAYAINRQG
FT                   MVDSILKGHGQLLNGPFLPGSWADAGTAVNYEYNVEKAKQLLAEDGWQPGPDGILQKDG
FT                   RKFEFTLQTNAGNERREQVAAVIQQNLKDVGIKVNIETLDFSSWVENYILPGKFQAILI
FT                   GWRLALDPDAESIFSSKYVPPNGQNAGWYKNEQIDQLWVEGYSTTDQEERKQVYAEIAR
FT                   LISQDLPYVFLYTQNVIAAYSDRVQWQEADKPVLTLPDGWQYNMEKWWLSDAQGGQ"
     MLRKARLGTA LALLLVVALV LVACGQGGGQ GPAQGEGGQQ QSAEGEQSRP QKGGTLTVGT        60
     FSDIITINPL FIDDVPSQEV ANLVLASLYD VDPQANVIVS DTSLAAELPQ ISEDGLSYTV       120
     KLKDTPKWTD GRPVTAEDVA WTIEMYANPE VGSPAIASFD KVDKVEVVDP QTVRVTLKQV       180
     YAPFLYTLAE LQPLPKHVFE GVAPKDLQKQ PYGTDPSKTV TNGPWKWTEW TQKQYVTLER       240
     NENYWGPEPY IDRVVFKIYA DQNTLAQAML NREIDILPGV DVKTLPALQG QSGIQIVEAP       300
     GPVYDYLGFN FKPENFPDGF VPWASQKTRQ AIAYAINRQG MVDSILKGHG QLLNGPFLPG       360
     SWADAGTAVN YEYNVEKAKQ LLAEDGWQPG PDGILQKDGR KFEFTLQTNA GNERREQVAA       420
     VIQQNLKDVG IKVNIETLDF SSWVENYILP GKFQAILIGW RLALDPDAES IFSSKYVPPN       480
     GQNAGWYKNE QIDQLWVEGY STTDQEERKQ VYAEIARLIS QDLPYVFLYT QNVIAAYSDR       540
     VQWQEADKPV LTLPDGWQYN MEKWWLSDAQ GGQ                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page