(data stored in ACNUC30630 zone)

EMBL: CP002344.PE296

CP002344.PE296       Location/Qualifiers
FT   CDS             346341..347339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0296"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003593:
FT                   IPR003439: IPR013563: IPR010066: IPR 017871; KEGG:
FT                   pjd:Pjdr2_4824 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50421"
FT                   /db_xref="GOA:E6SMG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG1"
FT                   /protein_id="ADU50421.1"
FT                   /translation="MAVAEPRVRTAEPLVKVEGLKKYFPITRGLLSRTVGYVRAVDGVS
FT                   LEIHPGETFGLVGESGCGKSTLARLVLRLIPATEGRVWFDGQDLFALPPAAMRKMRRQM
FT                   QIIFQDPFGSLNPRFTVADIIGEPLRVHGMRRRADRDRRVAELMEMVGLNPAWRHRFPH
FT                   QFSGGQRQRIGIARAIALNPRFVVADEAVSSLDVSVQAQILNLLADLQERLGLTYLFIA
FT                   HGLNVVRHVSTRVGVMYLGQLVEVAPVDELFSHPAHPYTAALLSAVPVPHPRRRRERIV
FT                   LQGDVPSPANPPAGCRFHPRCPFAQPRCREERPVLRTLTSGHAVACHFPLE"
     MAVAEPRVRT AEPLVKVEGL KKYFPITRGL LSRTVGYVRA VDGVSLEIHP GETFGLVGES        60
     GCGKSTLARL VLRLIPATEG RVWFDGQDLF ALPPAAMRKM RRQMQIIFQD PFGSLNPRFT       120
     VADIIGEPLR VHGMRRRADR DRRVAELMEM VGLNPAWRHR FPHQFSGGQR QRIGIARAIA       180
     LNPRFVVADE AVSSLDVSVQ AQILNLLADL QERLGLTYLF IAHGLNVVRH VSTRVGVMYL       240
     GQLVEVAPVD ELFSHPAHPY TAALLSAVPV PHPRRRRERI VLQGDVPSPA NPPAGCRFHP       300
     RCPFAQPRCR EERPVLRTLT SGHAVACHFP LE                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page