(data stored in ACNUC30630 zone)

EMBL: CP002344.PE300

CP002344.PE300       Location/Qualifiers
FT   CDS             350562..352028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0300"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR000120: IPR004412: IPR020556; KEGG: mta:Moth_2009
FT                   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A;
FT                   PFAM: Amidase; SPTR: Glutamyl-tRNA(Gln) amidotransferase
FT                   subunit A; TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; TIGRFAM: glutamyl-tRNA(Gln) and/or
FT                   aspartyl-tRNA(Asn) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50425"
FT                   /db_xref="GOA:E6SMG5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG5"
FT                   /protein_id="ADU50425.1"
FT                   /translation="MEELWFEPAHRLARRLEAGEISARELARAFLDRIQELDGTVGAYL
FT                   TVTAELALAQAREEDDKRRRGEPVGPLSGIPVAIKDNLCIQGVPTTAASKLLAGYRPPY
FT                   TATAVERLRKAGAVVLGKTNMDEFAMGSSTENSAFRITRNPWDPQRVPGGSSGGSAAAV
FT                   AAGEAAAALGSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGLIAFASSLDQIGPLTRDVT
FT                   DAALLMEAIAGHDPADATSAPVPVPSWRDALTGEVAGVRIGLPREFYGEAVEPEVAGAV
FT                   RAAVERLVADGAVADETSLPSAEHALPAYYLIATAEASSNLARYDGVRYGYRADAGNLA
FT                   DMYLETRKNFGPEVKRRILLGTFALREGYYDAYYRKALQVRRLIKDDFDRLFATFDVLI
FT                   TPTSPVVAFPLGARTADPLAMYAADICTLPVNLAGLPAVSVPCGFAGGLPVGLQIIGRP
FT                   FAEDMVLRVAYAIEQRLQLDLRPPLGRVAA"
     MEELWFEPAH RLARRLEAGE ISARELARAF LDRIQELDGT VGAYLTVTAE LALAQAREED        60
     DKRRRGEPVG PLSGIPVAIK DNLCIQGVPT TAASKLLAGY RPPYTATAVE RLRKAGAVVL       120
     GKTNMDEFAM GSSTENSAFR ITRNPWDPQR VPGGSSGGSA AAVAAGEAAA ALGSDTGGSI       180
     RQPAAFCGVV GLKPTYGRVS RYGLIAFASS LDQIGPLTRD VTDAALLMEA IAGHDPADAT       240
     SAPVPVPSWR DALTGEVAGV RIGLPREFYG EAVEPEVAGA VRAAVERLVA DGAVADETSL       300
     PSAEHALPAY YLIATAEASS NLARYDGVRY GYRADAGNLA DMYLETRKNF GPEVKRRILL       360
     GTFALREGYY DAYYRKALQV RRLIKDDFDR LFATFDVLIT PTSPVVAFPL GARTADPLAM       420
     YAADICTLPV NLAGLPAVSV PCGFAGGLPV GLQIIGRPFA EDMVLRVAYA IEQRLQLDLR       480
     PPLGRVAA                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page