(data stored in ACNUC30630 zone)

EMBL: CP002344.PE303

CP002344.PE303       Location/Qualifiers
FT   CDS             357524..358279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0303"
FT                   /product="geranylgeranylglyceryl phosphate synthase family
FT                   protein"
FT                   /EC_number="2.5.1.41"
FT                   /note="COGs: COG1646 phosphate-binding protein with
FT                   TIM-barrel fold; InterPro IPR008205; KEGG: sth:STH150
FT                   geranylgeranylglyceryl phosphate synthase-like protein;
FT                   PFAM: PcrB family protein; PRIAM: Phosphoglycerol
FT                   geranylgeranyltransferase; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: geranylgeranylglyceryl phosphate synthase
FT                   family protein; PFAM: PcrB family; TIGRFAM:
FT                   geranylgeranylglyceryl phosphate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50428"
FT                   /db_xref="GOA:E6SMG8"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG8"
FT                   /protein_id="ADU50428.1"
FT                   /translation="MDWRRWRHAVKLDPARPLDPEVVRGLATTGTDALILGGSDGIRRE
FT                   AVFHLLGAARATGLPVAIEVSSEEAVVPGADWYLIPMVLNTRDPRWLVGAHREAFQNLH
FT                   RIAPGIPVPWDRVVTVAYVVCNPDATVARVAAAVPPAGPDEVAAWTTVAERLLRADIVY
FT                   IEYSGRFGDPAWVGAAAGAMRGARLFYGGGIGTAEQAAVMAARAHTVVVGNALYRPGGL
FT                   ECIRATVEGARRVRPGEGGEPIAAGGRLP"
     MDWRRWRHAV KLDPARPLDP EVVRGLATTG TDALILGGSD GIRREAVFHL LGAARATGLP        60
     VAIEVSSEEA VVPGADWYLI PMVLNTRDPR WLVGAHREAF QNLHRIAPGI PVPWDRVVTV       120
     AYVVCNPDAT VARVAAAVPP AGPDEVAAWT TVAERLLRAD IVYIEYSGRF GDPAWVGAAA       180
     GAMRGARLFY GGGIGTAEQA AVMAARAHTV VVGNALYRPG GLECIRATVE GARRVRPGEG       240
     GEPIAAGGRL P                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page