(data stored in ACNUC30630 zone)

EMBL: CP002344.PE305

CP002344.PE305       Location/Qualifiers
FT   CDS             359327..359842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0305"
FT                   /product="phosphodiesterase, MJ0936 family protein"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro IPR000979:
FT                   IPR004843; KEGG: dau:Daud_0456 phosphodiesterase; PFAM:
FT                   metallophosphoesterase; SPTR: Phosphodiesterase, MJ0936
FT                   family; TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   Calcineurin-like phosphoesterase; TIGRFAM: phosphoesterase,
FT                   MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50430"
FT                   /db_xref="GOA:E6SMH0"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH0"
FT                   /protein_id="ADU50430.1"
FT                   /translation="MPTRVLVLSDTHVPGRARALPPAVLEAAARADLIVHAGDLVRLEV
FT                   YEELALLAPVVAVHGNVDDPEVYRRLPARAVFERDGVRVGVTHGHLGRAATTPARALEA
FT                   FAGEDVPPAVVVFGHSHQPLIQRQDGVLLVNPGSPTDPRQAPAPTYAWLELDGGEARAR
FT                   LVELSRRP"
     MPTRVLVLSD THVPGRARAL PPAVLEAAAR ADLIVHAGDL VRLEVYEELA LLAPVVAVHG        60
     NVDDPEVYRR LPARAVFERD GVRVGVTHGH LGRAATTPAR ALEAFAGEDV PPAVVVFGHS       120
     HQPLIQRQDG VLLVNPGSPT DPRQAPAPTY AWLELDGGEA RARLVELSRR P                171
//

If you have problems or comments...

PBIL Back to PBIL home page