(data stored in ACNUC30630 zone)

EMBL: CP002344.PE310

CP002344.PE310       Location/Qualifiers
FT   CDS             363808..364983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0310"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.99.5"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
FT                   subunit 7; InterPro IPR001135; KEGG: sth:STH2774 NADH
FT                   dehydrogenase I subunit D; PFAM: NADH-ubiquinone
FT                   oxidoreductase chain 49kDa; PRIAM: NADH dehydrogenase
FT                   (quinone); SPTR: NADH-quinone oxidoreductase subunit D 2;
FT                   PFAM: Respiratory-chain NADH dehydrogenase, 49 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50435"
FT                   /db_xref="GOA:E6SMH5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH5"
FT                   /protein_id="ADU50435.1"
FT                   /translation="MSLTREPVQPLELDPRLGDRVRIEPLDGGRQTMTMSMGPQHPSTH
FT                   GVLRVVLTLDGETVVDAQPDIGYLHRNWEKIAEYMTYAMTVPFSDRNDYLAAITNELAL
FT                   VQAVEKLTGIEVPERAQILRIIFSELQRITSHLLWFGTFGLDLGAVTAFLHAFTAREYC
FT                   YRLFERATGARFLYGYLRIGGMRNDVPDGWVEDLLSFVDQLERTYWPEFMRLLIDNAIF
FT                   IRRTKGIGVLKPEVAVAYGASGPVLRGSGVKYDVRKADNYLPYDRFEFDIPVGENGDVY
FT                   DRAVVRMYEMLESAKIIRQAVKELPDGPVMAKVPRAIRPYGEVYHRVEGPRGEVGVYLV
FT                   AAGDTNAYRARWRSPCFVHLQLLPLLARGHLVADVVAIIGSIDIVLGEVDR"
     MSLTREPVQP LELDPRLGDR VRIEPLDGGR QTMTMSMGPQ HPSTHGVLRV VLTLDGETVV        60
     DAQPDIGYLH RNWEKIAEYM TYAMTVPFSD RNDYLAAITN ELALVQAVEK LTGIEVPERA       120
     QILRIIFSEL QRITSHLLWF GTFGLDLGAV TAFLHAFTAR EYCYRLFERA TGARFLYGYL       180
     RIGGMRNDVP DGWVEDLLSF VDQLERTYWP EFMRLLIDNA IFIRRTKGIG VLKPEVAVAY       240
     GASGPVLRGS GVKYDVRKAD NYLPYDRFEF DIPVGENGDV YDRAVVRMYE MLESAKIIRQ       300
     AVKELPDGPV MAKVPRAIRP YGEVYHRVEG PRGEVGVYLV AAGDTNAYRA RWRSPCFVHL       360
     QLLPLLARGH LVADVVAIIG SIDIVLGEVD R                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page