(data stored in ACNUC30630 zone)

EMBL: CP002344.PE315

CP002344.PE315       Location/Qualifiers
FT   CDS             367546..369429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0315"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterPro IPR003916: IPR018393: IPR003945: IPR001516: IPR
FT                   001750; KEGG: mta:Moth_0985 proton-translocating
FT                   NADH-quinone oxidoreductase, chain L; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); NADH-Ubiquinone
FT                   oxidoreductase (complex I) chain 5/L domain protein; SPTR:
FT                   Proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5 N-terminus; NADH-Ubiquinone/plastoquinone (complex
FT                   I), various chains; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50440"
FT                   /db_xref="GOA:E6SMI0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI0"
FT                   /protein_id="ADU50440.1"
FT                   /translation="MVESAWLIPLFPLAAFVLTVFVGRRLGERAGWIGVAGMLAATVMA
FT                   LGVFRDAVVRPEAYEAAWRWLQFGSFELRVGFRVDNLEATLLLMVSFVSLMVHVFSLGY
FT                   MHGDARYNRYFALISLFTAGMLGLVISDNAVFWLLWWEIMGACSYLLIGHWFEERENQA
FT                   AAYKAFITTRIGDVLMMAGFWYMFHLTGSLRFADWQAWVEHQAGAGAPDFTRAMTVAAL
FT                   LIFGGAVGKSAQAPLHVWLPDAMAGPTPVSALIHAATMVAAGVFLIARTYFIFAQSPTA
FT                   LAVVAFLGAFTAFLAASIAVVQSDIKKVLAYSTVSQLGYMVMALGVGGYTAALFHLWTH
FT                   GFFKALLFLGSGSVIHAVHTQNMHEMGGLARKMKLTAATFIVGTLALAGIWPFSGFYSK
FT                   DEILLAAYHSRYPVLFWVGAATAGLTAFYMTRAVVLTFFGRPRDAHKYEHAHEGGPELT
FT                   WPLLLLAIPAFAAGFLAPALFGAPVHEFITFGEHVSGYEPESVVVLTGTLFAVAGILLG
FT                   IVVYGLGWISPQTLRAAFATPYFVLQEKWFFDRAYQAVVLAGSSAVARLAAGFDRLVID
FT                   GIVNGVARLVAGVGEVVRRWSTGLVQGYMLTLFAGVVVLALLILQVTGGLR"
     MVESAWLIPL FPLAAFVLTV FVGRRLGERA GWIGVAGMLA ATVMALGVFR DAVVRPEAYE        60
     AAWRWLQFGS FELRVGFRVD NLEATLLLMV SFVSLMVHVF SLGYMHGDAR YNRYFALISL       120
     FTAGMLGLVI SDNAVFWLLW WEIMGACSYL LIGHWFEERE NQAAAYKAFI TTRIGDVLMM       180
     AGFWYMFHLT GSLRFADWQA WVEHQAGAGA PDFTRAMTVA ALLIFGGAVG KSAQAPLHVW       240
     LPDAMAGPTP VSALIHAATM VAAGVFLIAR TYFIFAQSPT ALAVVAFLGA FTAFLAASIA       300
     VVQSDIKKVL AYSTVSQLGY MVMALGVGGY TAALFHLWTH GFFKALLFLG SGSVIHAVHT       360
     QNMHEMGGLA RKMKLTAATF IVGTLALAGI WPFSGFYSKD EILLAAYHSR YPVLFWVGAA       420
     TAGLTAFYMT RAVVLTFFGR PRDAHKYEHA HEGGPELTWP LLLLAIPAFA AGFLAPALFG       480
     APVHEFITFG EHVSGYEPES VVVLTGTLFA VAGILLGIVV YGLGWISPQT LRAAFATPYF       540
     VLQEKWFFDR AYQAVVLAGS SAVARLAAGF DRLVIDGIVN GVARLVAGVG EVVRRWSTGL       600
     VQGYMLTLFA GVVVLALLIL QVTGGLR                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page