(data stored in ACNUC30630 zone)

EMBL: CP002344.PE327

CP002344.PE327       Location/Qualifiers
FT   CDS             380938..383583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0327"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="InterPro IPR000788: IPR013344: IPR013509; KEGG:
FT                   ttr:Tter_0049 ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; SPTR: Ribonucleoside-diphosphate reductase;
FT                   TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: Ribonucleotide
FT                   reductase, all-alpha domain; Ribonucleotide reductase,
FT                   barrel domain; TIGRFAM: ribonucleoside-diphosphate
FT                   reductase, adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50452"
FT                   /db_xref="GOA:E6SMJ2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ2"
FT                   /protein_id="ADU50452.1"
FT                   /translation="MELTGIRRTVFLDRYARKGPDGKPVESSPEEMWDRVARAIAEVEE
FT                   PGQREVWERRFRQALEGFKFVPGGRILAGAGTGNKVTYYNCYVIPSPEDSRKGIMDNVS
FT                   LMVEIMSRGGGVGVNLSTLRPRGTYVRGVNGTASGPVSWAEVYSTATGSVIQGGSRRGA
FT                   LMLMLDDDHPDIEEFITVKRDLTKITNANLSVCISDAFMEAVQQDLPWDLKWNGKVYKT
FT                   VRARDLWELICESAWASGEPGVVFMERVNKRSNTWYCEPINCVNPCGEQPLGPWGVCNL
FT                   GAINLAAFVHEGELDLEGLKDTVAVAVRFLDNVIDATEYFFPENEKAQRYGVRRIGLGT
FT                   MGLADMLIKLRIRYGSEKAFEVCDQVYRLIRDEAYRTSALLAKEKGAFPWFDKEKYLQG
FT                   WFIQRLPEDIRQLIAQHGIRNGFLLTQAPTGTTSLLAGVSSGIEPVFAFSFKRTDRTGT
FT                   HIVYHELYKEWLEKHPDEPVPDYFVSADQLTPEEHVRMQAIIQQYVDASISKTVNAPRE
FT                   HTVDQVRTLYRLAYELGCKGITYYRDGSREGVLHKLDDGGKAKQGKGTGQGKGQAGSEA
FT                   AAAADGAATTAAGGAGAAATAAAVPAGAAAGAGTGAEAATAQLRVTWGHIRPIERPSKL
FT                   NGFTVRRTTPLGNLYLTLNTFNGYPFELFAQIGKAGSDVAAFTEAIARLVSLAFRAGVD
FT                   PHEVVEQLRGIGGSRSVGFGPNRVLSVPDAIAQFLDDYMAGKIERDPVDEVAAGQLTVF
FT                   SADPAQQAREAVAAARAGQPAAGEAGGAGGTGEAGQVGFNLAAAGTGGAAGGNGGTGGN
FT                   GTGRGPSEPGSAVVVNGTPGAPAAEPPAPRITGGNGRELSMDLCPECGSHALVREEGCS
FT                   KCLACGYSEC"
     MELTGIRRTV FLDRYARKGP DGKPVESSPE EMWDRVARAI AEVEEPGQRE VWERRFRQAL        60
     EGFKFVPGGR ILAGAGTGNK VTYYNCYVIP SPEDSRKGIM DNVSLMVEIM SRGGGVGVNL       120
     STLRPRGTYV RGVNGTASGP VSWAEVYSTA TGSVIQGGSR RGALMLMLDD DHPDIEEFIT       180
     VKRDLTKITN ANLSVCISDA FMEAVQQDLP WDLKWNGKVY KTVRARDLWE LICESAWASG       240
     EPGVVFMERV NKRSNTWYCE PINCVNPCGE QPLGPWGVCN LGAINLAAFV HEGELDLEGL       300
     KDTVAVAVRF LDNVIDATEY FFPENEKAQR YGVRRIGLGT MGLADMLIKL RIRYGSEKAF       360
     EVCDQVYRLI RDEAYRTSAL LAKEKGAFPW FDKEKYLQGW FIQRLPEDIR QLIAQHGIRN       420
     GFLLTQAPTG TTSLLAGVSS GIEPVFAFSF KRTDRTGTHI VYHELYKEWL EKHPDEPVPD       480
     YFVSADQLTP EEHVRMQAII QQYVDASISK TVNAPREHTV DQVRTLYRLA YELGCKGITY       540
     YRDGSREGVL HKLDDGGKAK QGKGTGQGKG QAGSEAAAAA DGAATTAAGG AGAAATAAAV       600
     PAGAAAGAGT GAEAATAQLR VTWGHIRPIE RPSKLNGFTV RRTTPLGNLY LTLNTFNGYP       660
     FELFAQIGKA GSDVAAFTEA IARLVSLAFR AGVDPHEVVE QLRGIGGSRS VGFGPNRVLS       720
     VPDAIAQFLD DYMAGKIERD PVDEVAAGQL TVFSADPAQQ AREAVAAARA GQPAAGEAGG       780
     AGGTGEAGQV GFNLAAAGTG GAAGGNGGTG GNGTGRGPSE PGSAVVVNGT PGAPAAEPPA       840
     PRITGGNGRE LSMDLCPECG SHALVREEGC SKCLACGYSE C                           881
//

If you have problems or comments...

PBIL Back to PBIL home page