(data stored in ACNUC30630 zone)

EMBL: CP002344.PE332

CP002344.PE332       Location/Qualifiers
FT   CDS             complement(387224..387841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0332"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="COGs: COG0634 Hypoxanthine-guanine
FT                   phosphoribosyltransferase; InterPro IPR005904: IPR000836;
FT                   KEGG: amt:Amet_2903 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; PRIAM: Hypoxanthine
FT                   phosphoribosyltransferase; SPTR: Hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50457"
FT                   /db_xref="GOA:E6SMJ7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ7"
FT                   /protein_id="ADU50457.1"
FT                   /translation="MSVNEPGATAPGGPRKARIDRVLFSQEAIAGKVRELAERIRQDYA
FT                   AVPGANGTGGHGAPLTVVGILKGAFVFTADLVRALGALDVPLQVDFMAVSSYGTATQTS
FT                   GIIRILKDLDRPIRGQHVLLIEDIVDTGLTLRYLREHLMAQDPASLRACVLLDKPERRL
FT                   VDVPVEYVGFQIPDEFVVGYGIDYAEQFRYLPYIACVRLEPQ"
     MSVNEPGATA PGGPRKARID RVLFSQEAIA GKVRELAERI RQDYAAVPGA NGTGGHGAPL        60
     TVVGILKGAF VFTADLVRAL GALDVPLQVD FMAVSSYGTA TQTSGIIRIL KDLDRPIRGQ       120
     HVLLIEDIVD TGLTLRYLRE HLMAQDPASL RACVLLDKPE RRLVDVPVEY VGFQIPDEFV       180
     VGYGIDYAEQ FRYLPYIACV RLEPQ                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page