(data stored in ACNUC30630 zone)

EMBL: CP002344.PE335

CP002344.PE335       Location/Qualifiers
FT   CDS             complement(392450..393430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0335"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR003593:
FT                   IPR016366: IPR011703; KEGG: sth:STH2553 methanol
FT                   dehydrogenase regulatory protein; PFAM: ATPase associated
FT                   with various cellular activities AAA_3; SMART: AAA ATPase;
FT                   SPTR: Methanol dehydrogenase regulatory protein; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50460"
FT                   /db_xref="GOA:E6SMK0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMK0"
FT                   /protein_id="ADU50460.1"
FT                   /translation="MQRVQEVAGRVMASVERVIVGKRAEIRYLLAALLANRHVLIEDVP
FT                   GVGKTTMVRALARSIDCTFRRIQFTPDLLPSDITGLSVYDPATRQFTFRPGPIHSQVVL
FT                   ADEINRTSPKTQSALLEAMEEGQVTVDGQTYPLPRPFFVLATQNPIEYEGTFPLPESQL
FT                   DRFGLRIRLGYPRPAEERAILDLHHAGRPVDALQPVTTAEEILELQQLITQVHVDDSVK
FT                   DYLVRIVQATRAHSAVYLGASPRASLSLYRLSQALAAMDGRDYVLPDDVKELAPLVLAH
FT                   RLVLQPEARWHDTDPEAVVRDVLEHVPAPVERRAERWAGSLLRRR"
     MQRVQEVAGR VMASVERVIV GKRAEIRYLL AALLANRHVL IEDVPGVGKT TMVRALARSI        60
     DCTFRRIQFT PDLLPSDITG LSVYDPATRQ FTFRPGPIHS QVVLADEINR TSPKTQSALL       120
     EAMEEGQVTV DGQTYPLPRP FFVLATQNPI EYEGTFPLPE SQLDRFGLRI RLGYPRPAEE       180
     RAILDLHHAG RPVDALQPVT TAEEILELQQ LITQVHVDDS VKDYLVRIVQ ATRAHSAVYL       240
     GASPRASLSL YRLSQALAAM DGRDYVLPDD VKELAPLVLA HRLVLQPEAR WHDTDPEAVV       300
     RDVLEHVPAP VERRAERWAG SLLRRR                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page