(data stored in ACNUC30630 zone)

EMBL: CP002344.PE343

CP002344.PE343       Location/Qualifiers
FT   CDS             406155..406688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0344"
FT                   /product="protein of unknown function DUF124"
FT                   /note="COGs: COG2013 conserved hypothetical protein;
FT                   InterPro IPR002838; KEGG: sth:STH841 hypothetical protein;
FT                   PFAM: protein of unknown function DUF124; SPTR: Putative
FT                   uncharacterized protein; manually curated; PFAM: Protein of
FT                   unknown function DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50468"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG51"
FT                   /protein_id="ADU50468.1"
FT                   /translation="MAFGENGGKRPERAFSNFKTSGGWRYRPRWVRFLHAPAKRYRGYT
FT                   LSGCGRFTSSWHRPLRHANCNRGPAPVRRGSGHPAEDSPERSPTCRYGGGTGRDDGYLK
FT                   PGERYVVDTGHVVAFSDGMGFQVRRAGTGWFSSIASGEGLACEFTGPGTVYIQTRSEAS
FT                   FLGWLIPKLPAKRD"
     MAFGENGGKR PERAFSNFKT SGGWRYRPRW VRFLHAPAKR YRGYTLSGCG RFTSSWHRPL        60
     RHANCNRGPA PVRRGSGHPA EDSPERSPTC RYGGGTGRDD GYLKPGERYV VDTGHVVAFS       120
     DGMGFQVRRA GTGWFSSIAS GEGLACEFTG PGTVYIQTRS EASFLGWLIP KLPAKRD          177
//

If you have problems or comments...

PBIL Back to PBIL home page